NDRG2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83902-7-RR (same clone as 83902-7-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83902-7-RR (NDRG2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83902-7-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 83902-7-RR (same clone as 83902-7-PBS)

  WB result of NDRG2 antibody (83902-7-RR; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-NDRG2 transfected HepG2 cells. This data was developed using the same antibody clone with 83902-7-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 83902-7-RR (same clone as 83902-7-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 83902-7-RR (NDRG2 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83902-7-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 83902-7-RR (same clone as 83902-7-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 83902-7-RR (NDRG2 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83902-7-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 83902-7-RR (same clone as 83902-7-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug NDRG2 Recombinant antibody (83902-7-RR, Clone:241039E8) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 83902-7-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83902-7-RR

  Biolayer interferometry (BLl) kinetic assays of 83902-7-RR against Human NDRG2 were performed. The affinity constant is 0.114 nM.

• Featured Product
• KD/KO Validated

NDRG2 Uni-rAb^® Recombinant Antibody for WB, IHC, FC (Intra), Indirect ELISA

Cat No. 83902-7-PBS

Clone No.241039E8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), Indirect ELISA

Synonyms

241039E8, NDRG family member 2, N-myc downstream-regulated gene 2 protein, Protein NDRG2, Protein Syld709613

---

Product Information

83902-7-PBS targets NDRG2 in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2629

  Product name: Recombinant human NDRG2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-357 aa of BC010458

  Sequence: MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYVSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPGHTMEVSC

• Full Name: NDRG family member 2
• Calculated Molecular Weight: 371 aa, 39 kDa
• Observed Molecular Weight: 41-45 kDa
• GenBank Accession Number: BC010458
• Gene Symbol: NDRG2
• Gene ID (NCBI): 57447
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9UN36
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

N-myc downstream-regulated gene 2 (NDRG2) is a newly identified member of the NDRG family that is highly localized and plays an important role in the regulation of astrocyte function. In astrocytes, NDRG2 affects the regulation of apoptosis, astrogliosis, blood-brain barrier integrity, and glutamate clearance. Several preclinical studies have revealed that NDRG2 is implicated in the pathogenesis of many neurological diseases, such as stroke, neurodegeneration and psychiatric disorders. Recent studies demonstrated that NDRG2 functions as a tumor suppressor and may be a prognostic predictor for many different malignant tumors.