• Featured Product
  • KD/KO Validated

NDRG2 Recombinant monoclonal antibody, PBS Only

NDRG2 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), Indirect ELISA
Cat No. 83902-7-PBS
Clone No.241039E8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), Indirect ELISA

241039E8, NDRG family member 2, N-myc downstream-regulated gene 2 protein, Protein NDRG2, Protein Syld709613

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83902-7-PBS targets NDRG2 in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2629

Product name: Recombinant human NDRG2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-357 aa of BC010458

Sequence: MAELQEVQITEEKPLLPGQTPEAAKTHSVETPYVSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPGHTMEVSC

Predict reactive species
Full Name NDRG family member 2
Calculated Molecular Weight 371 aa, 39 kDa
Observed Molecular Weight41-45 kDa
GenBank Accession NumberBC010458
Gene Symbol NDRG2
Gene ID (NCBI) 57447
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ9UN36
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

N-myc downstream-regulated gene 2 (NDRG2) is a newly identified member of the NDRG family that is highly localized and plays an important role in the regulation of astrocyte function. In astrocytes, NDRG2 affects the regulation of apoptosis, astrogliosis, blood-brain barrier integrity, and glutamate clearance. Several preclinical studies have revealed that NDRG2 is implicated in the pathogenesis of many neurological diseases, such as stroke, neurodegeneration and psychiatric disorders. Recent studies demonstrated that NDRG2 functions as a tumor suppressor and may be a prognostic predictor for many different malignant tumors.

Loading...
||
New chat Able
正在加载,请稍候...