NDRG3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NDRG3 Polyclonal antibody, PBS Only (31421-1-PBS)

• 

  WB analysis using 31421-1-AP (same clone as 31421-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31421-1-AP (NDRG3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31421-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 31421-1-AP (same clone as 31421-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31421-1-AP (NDRG3 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31421-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 31421-1-AP (same clone as 31421-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 31421-1-AP (NDRG3 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31421-1-PBS in a different storage buffer formulation.

NDRG3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 31421-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

Protein NDRG3

---

Product Information

31421-1-PBS targets NDRG3 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33626

  Product name: Recombinant human NDRG3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 178-237 aa of NM_032013

  Sequence: LSGLTTNVVDIILAHHFGQEELQANLDLIQTYRMHIAQDINQDNLQLFLNSYNGRRDLEI*

• Full Name: NDRG family member 3
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 41-45 kDa
• GenBank Accession Number: NM_032013
• Gene Symbol: NDRG3
• Gene ID (NCBI): 57446
• RRID: AB_3669974
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9UGV2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NDRG (N-Myc downstream-regulated gene) family is generally divided into two subfamilies, one composed of NDRG1 and NDRG3 with a homology of 67%, and the other composed of NDRG2 and NDRG4 with a homology of 58%. NDRG3 is a downstream regulatory factor of MYC, with a total length of 2588 base pairs. It is mainly expressed in ovary, prostate, testis, brain, spinal cord, thymus, heart and kidney. NDRG3 is located on chromosome 20q11.21-11.23 and encodes at least two subtypes, 375 and 363 amino acids, respectively, with an apparent molecular weight of 41 and 40 kDa, respectively. (PMID: 36619553)