Product Information
31421-1-PBS targets NDRG3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag33626 Product name: Recombinant human NDRG3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 178-237 aa of NM_032013 Sequence: LSGLTTNVVDIILAHHFGQEELQANLDLIQTYRMHIAQDINQDNLQLFLNSYNGRRDLEI* Predict reactive species |
| Full Name | NDRG family member 3 |
| Calculated Molecular Weight | 41 kDa |
| Observed Molecular Weight | 41-45 kDa |
| GenBank Accession Number | NM_032013 |
| Gene Symbol | NDRG3 |
| Gene ID (NCBI) | 57446 |
| RRID | AB_3669974 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9UGV2 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
NDRG (N-Myc downstream-regulated gene) family is generally divided into two subfamilies, one composed of NDRG1 and NDRG3 with a homology of 67%, and the other composed of NDRG2 and NDRG4 with a homology of 58%. NDRG3 is a downstream regulatory factor of MYC, with a total length of 2588 base pairs. It is mainly expressed in ovary, prostate, testis, brain, spinal cord, thymus, heart and kidney. NDRG3 is located on chromosome 20q11.21-11.23 and encodes at least two subtypes, 375 and 363 amino acids, respectively, with an apparent molecular weight of 41 and 40 kDa, respectively. (PMID: 36619553)









