NDRG4 Polyclonal antibody

• 

  WB analysis using 33254-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33254-1-AP (NDRG4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

NDRG4 Polyclonal Antibody for WB, ELISA

Cat No. 33254-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

BDM1, Brain development-related molecule 1, NDRG family member 4, N-myc downstream-regulated gene 4 protein, Protein NDRG4

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse cerebellum tissue, rat brain tissue, rat cerebellum tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33254-1-AP targets NDRG4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38351

  Product name: Recombinant human NDRG4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 42-223 aa of BC011795

  Sequence: NHKLCFNTFFNFEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQFPSMEQLAAMLPSVVQHFGFKYVIGIGVGAGAYVLAKFALIFPDLVEGLVLVNIDPNGKGWIDWAATKLSGLTSTLPDTVLSHLFSQEELVNNTELVQSYRQQIGNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAK

• Full Name: NDRG family member 4
• Calculated Molecular Weight: 339 aa, 37 kDa
• Observed Molecular Weight: 37 kDa, 38 kDa and 41 kDa
• GenBank Accession Number: BC011795
• Gene Symbol: NDRG4
• Gene ID (NCBI): 65009
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9ULP0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NDRG4 (N-myc downstream-regulated gene 4) is a member of the NDRG family (NDRG1-4), a group of evolutionarily conserved proteins implicated in cell differentiation, stress responses, and tumor suppression. Unlike other family members (e.g., NDRG1 linked to cancer metastasis), NDRG4 is highly expressed in the brain and heart, with emerging roles in neuronal development and cardiovascular function. Methylation of NDRG4 in stool DNA is a diagnostic marker for colorectal cancer.