NDST1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NDST1 Polyclonal antibody (26203-1-AP)

• Featured Product
• KD/KO Validated

NDST1 Polyclonal Antibody for WB, IP, ELISA

Cat No. 26203-1-AP Copied!

Publications (22)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

[Heparan sulfate]-glucosamine N-sulfotransferase 1, Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1, Glucosaminyl N-deacetylase/N-sulfotransferase 1, Heparan sulfate N-deacetylase 1, Heparan sulfate N-sulfotransferase 1

• 

  WB analysis using 26203-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26203-1-AP (NDST1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 26203-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26203-1-AP (NDST1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse heart using 26203-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 26203-1-AP (NDST1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 26203-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 26203-1-AP (NDST1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse liver using 26203-1-AP

  IP result of anti-NDST1 (IP:26203-1-AP, 4ug; Detection:26203-1-AP 1:500) with mouse liver tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NDST1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: rat brain tissue, mouse heart tissue, mouse liver tissue, rat liver tissue
• Positive IP detected in: mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26203-1-AP targets NDST1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24422

  Product name: Recombinant human NDST1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 38-90 aa of BC012888

  Sequence: LYGWKRGLEPSADAPEPDCGDPPPVAPSRLLPLKPVQAATPSRTDPLVLVFVE

• Full Name: N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1
• Calculated Molecular Weight: 882 aa, 101 kDa
• Observed Molecular Weight: 68-70 kDa
• GenBank Accession Number: BC012888
• Gene Symbol: NDST1
• Gene ID (NCBI): 3340
• RRID: AB_2880423
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P52848
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NDST1 encodes the bifunctional GlcNAc N-deacetylase/N-sulfotransferase NDST1, which has an important function in the generation of sulfated ligandbinding sites during heparan sulfate biosynthesis. NDST1 is a type II transmembrane protein that resides in the Golgi apparatus and catalyzes both N-deacetylation and N-sulfation of N-acetylglucosamine (GlcNAc) units of the HS polysaccharide chain (PMID: 25125150). In mice, Ndst1 is crucial for embryonic development and homozygous null mutations are perinatally lethal (PMID: 16020517, 38129107).

Publications

What published studies show

NDST1 Polyclonal antibody (Cat# 26203-1-AP) has 22 citations published in journals including Nature Communications, Journal of Extracellular Vesicles, Advanced Science, Oncogene, Annals of Neurology, Experimental Molecular Medicine, and Journal of Nanobiotechnology. Associated research fields encompass extracellular vesicle and migrasome biology, neurology (Parkinson's disease, nerve regeneration), oncology (renal cell carcinoma, glioblastoma, nasopharyngeal carcinoma), nephrology (diabetic kidney disease, lupus nephritis), post-infarction cardiac injury, and reproductive immunology.

Automatically generated from the 22 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB,IF	J Extracell Vesicles; M2 Macrophage-Derived Migrasomes Mediate Ischaemia-Induced Retinal Neovascularization by Targeting TREM2.; Authors - Bingyan Li
human	WB	J Extracell Vesicles; Quantification of urinary podocyte-derived migrasomes for the diagnosis of kidney disease; Authors - Rong Yang
rat,human	WB	Nat Commun; Macrophage lineage cells-derived migrasomes activate complement-dependent blood-brain barrier damage in cerebral amyloid angiopathy mouse model; Authors - Mengyan Hu
mouse	WB	Exp Mol Med; PGC-1α mediates migrasome secretion accelerating macrophage-myofibroblast transition and contributing to sepsis-associated pulmonary fibrosis; Authors - Yawen Peng
human	WB	J Nanobiotechnology; TSPAN4-positive migrasome derived from retinal pigmented epithelium cells contributes to the development of proliferative vitreoretinopathy; Authors - Liangjing Wu
mouse	WB	J Nanobiotechnology; A migrasome-based osteoinductive strategy: reprogramming the bone microenvironment for accelerated coupling of angiogenesis and osteogenesis.; Authors - Leyi Liu