NDST3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NDST3 Polyclonal antibody, PBS Only (21569-1-PBS)

• 

  WB analysis using 21569-1-AP (same clone as 21569-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21569-1-AP (NDST3 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21569-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 21569-1-AP (same clone as 21569-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21569-1-AP (NDST3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21569-1-PBS in a different storage buffer formulation.

NDST3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21569-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

hNDST-3, HSST3, NDST-3

---

Product Information

21569-1-PBS targets NDST3 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16091

  Product name: Recombinant human NDST3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 180-261 aa of BC109309

  Sequence: FPFSIYGNLAVKDCCINPHSPLIRVTKSSKLEKGSLPGTDWTVFQINHSAYQPVIFAKVKTPENLSPSISKGAFYATIIHDL

• Full Name: N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 3
• Calculated Molecular Weight: 873 aa, 101 kDa
• Observed Molecular Weight: 44 kDa, 64 kDa, 101 kDa
• GenBank Accession Number: BC109309
• Gene Symbol: NDST3
• Gene ID (NCBI): 9348
• RRID: AB_3742044
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95803
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NDST3 (Glucosaminyl N-deacetylase/N-sulfotransferase 3) is known to catalyze deacetylation and N-sulfation on disaccharide substrates. Aberrant NDST3 expression or tubulin acetylation has been observed in an increasing number of NDs, including amyotrophic lateral sclerosis and frontotemporal dementia (ALS/FTD), schizophrenia and bipolar disorder, Alzheimer's disease (AD), and Parkinson's disease (PD) (PMID: 41268696, 34435379).