GRIM19 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GRIM19 Polyclonal antibody (10986-1-AP)

• Featured Product
• KD/KO Validated

GRIM19 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 10986-1-AP Copied!

Publications (19)

Reviews (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

NDUFA13, B16.6, CDA016, Cell death regulatory protein GRIM-19, CGI 39

• 

  WB analysis of HEK-293 using 10986-1-AP

  WB result of GRIM19 antibody (10986-1-AP; 1:1500; incubated at room temperature for 1.5 hours) with sh-Control and sh-GRIM19 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10986-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10986-1-AP (GRIM19 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 10986-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10986-1-AP (GRIM19 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 10986-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 10986-1-AP (GRIM19 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10986-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 10986-1-AP (GRIM19 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HEK-293 using 10986-1-AP

  IP result of anti-GRIM19 (IP:10986-1-AP, 4ug; Detection:10986-1-AP 1:500) with HEK-293 cells lysate 2000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 10986-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 10986-1-AP (GRIM19 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 10986-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 10986-1-AP (GRIM19 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 10986-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 10986-1-AP (GRIM19 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 10986-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 10986-1-AP (GRIM19 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 10986-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 10986-1-AP (GRIM19 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 10986-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 10986-1-AP (GRIM19 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GRIM19 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse heart tissue, HEK-293 cells, MCF-7 cells, rat heart tissue
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human prostate cancer tissue, human heart tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10986-1-AP targets GRIM19 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1435

  Product name: Recombinant human GRIM19 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-144 aa of BC009189

  Sequence: MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT

• Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13
• Calculated Molecular Weight: 16.5 kDa
• Observed Molecular Weight: 16-18 kDa
• GenBank Accession Number: BC009189
• Gene Symbol: GRIM19
• Gene ID (NCBI): 51079
• RRID: AB_2150609
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P0J0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GRIM19(Gene associated with retinoic and interferon-induced mortality 19 protein) is also named as NDUFA13 ,CI-B16.6 and belongs to the complex I NDUFA13 subunit family. GRIM-19 may distribute in the mitochondria and/or nucleus depending on the cell type.Alternatively, its cellular localization may be regulated by post-translational modifications such as phosphorylation and acetylation. Lastly, GRIM-19 may exist in different isoforms that may be distributed in distinct cellular locations(PMID:12628925).

Publications

What published studies show

The GRIM-19 (NDUFA13) antibody, catalog number 10986-1-AP, has 19 citations spanning journals including Nature Metabolism, Theranostics, Developmental Cell, Cell & Molecular Life Sciences, iScience, EMBO Reports, and BMC Biology. Research fields covered include mitochondrial respiration, cancer (glioblastoma, colorectal, bladder, renal cell carcinoma), cardiac remodeling, kidney fibrosis, neuroinflammation, RNA modification, gene therapy, and cell division. Applications are predominantly WB and IHC.

Automatically generated from the 19 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Nat Metab; Hypoxia rescues complex 1-associated disease caused by proteostatic defects.; Authors - Ankur Garg
human	WB,IF	Theranostics; Nitric oxide-primed engineered extracellular vesicles restore bioenergetics in acute kidney injury via mitochondrial transfer; Authors - Fei Peng
human	WB	Dev Cell; PDGF signaling inhibits mitophagy in glioblastoma stem cells through N6-methyladenosine.; Authors - Deguan Lv
mouse	WB,IHC	Int J Mol Med; Moderate downregulation of NDUFA13 promotes cardiomyocytes proliferation and heart regeneration through the glycolysis/c‑Myc/Ccnd1 axis.; Authors - Ying Gao
rat	WB	Phytother Res; Icariside II prevents kidney fibrosis development in chronic kidney disease by promoting fatty acid oxidation; Authors - Meng Wang
		Int J Oncol; Atrazine promotes RM1 prostate cancer cell proliferation by activating STAT3 signaling.; Authors - Kebang Hu

Reviews

4.0 out of 5

3 verified customer reviews

What customers say

Users report mixed results for this antibody in Western Blot on fibroblasts at 1:1000 dilution. Two reviewers gave 5-star ratings, noting a diffuse band at the expected size (requiring 2 hours RT incubation) and consistent signal intensity between replicates. One reviewer gave 2 stars, describing the band as difficult to see with inconsistent performance across runs. Overall, results appear variable, with some users achieving reliable detection while others experienced weak or inconsistent signals.

Automatically generated from the 3 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Matthieu (Verified Customer) (09-24-2025)

Bande diffuse à la taille attendu - Nécessite 2h d'incubation à RT

• Applications: Western Blot
• Primary Antibody Dilution: 1/1000
• Cell Tissue Type: human fibroblasts

Emilie (Verified Customer) (09-24-2025)

Delivered consistent signal intensity between replicates.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Fibroblasts

Manon (Verified Customer) (09-19-2025)

Difficult to see the band, sometimes it works sometimes not

• Applications: Western Blot
• Primary Antibody Dilution: 1/1000
• Cell Tissue Type: Fibroblasts