NDUFA2 Polyclonal antibody

• 

  WB analysis using 15889-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15889-1-AP (NDUFA2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse heart using 15889-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 15889-1-AP (NDUFA2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 15889-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 15889-1-AP (NDUFA2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

NDUFA2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15889-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

B8, CI B8, Complex I B8, NDUFA2

---

Tested Applications

• Positive WB detected in: mouse heart tissue, mouse liver tissue, rat heart tissue
• Positive IHC detected in: mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15889-1-AP targets NDUFA2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8675

  Product name: Recombinant human NDUFA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-99 aa of BC003674

  Sequence: MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA

• Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa
• Calculated Molecular Weight: 99 aa, 11 kDa
• Observed Molecular Weight: 11 kDa
• GenBank Accession Number: BC003674
• Gene Symbol: NDUFA2
• Gene ID (NCBI): 4695
• RRID: AB_3669223
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43678
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NDUFA2(NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2), also known as NADH ubiquinone oxidoreductase B8 subunit, is one of accessory subunits of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). NDUFS2 is vital for growth, ROS generation, membrane integrity, apoptosis, and mitochondrial energetics.