NDUFA4L2 Polyclonal antibody

• 

  WB analysis using 16480-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16480-1-AP (NDUFA4L2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 16480-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16480-1-AP (NDUFA4L2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 16480-1-AP

  IP result of anti-NDUFA4L2 (IP:16480-1-AP, 4ug; Detection:16480-1-AP 1:500) with HeLa cells lysate 1200ug.

• 

  IHC staining of human liver cancer using 16480-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16480-1-AP (NDUFA4L2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 16480-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16480-1-AP (NDUFA4L2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 16480-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 16480-1-AP (NDUFA4L2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 16480-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 16480-1-AP (NDUFA4L2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 16480-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 16480-1-AP (NDUFA4L2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 16480-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 16480-1-AP (NDUFA4L2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 16480-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16480-1-AP (NDUFA4L2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 16480-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16480-1-AP (NDUFA4L2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 16480-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 16480-1-AP (NDUFA4L2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 16480-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 16480-1-AP (NDUFA4L2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 16480-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using NDUFA4L2 antibody (16480-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

NDUFA4L2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 16480-1-AP

Publications(29)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

NUOMS, NADH-ubiquinone oxidoreductase MLRQ subunit homolog, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2

---

Tested Applications

• Positive WB detected in: COLO 320 cells, HeLa cells, HUVEC cells, HepG2 cells, Jurkat clells, PC-3 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human liver cancer tissue, human kidney tissue, human liver tissue, mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 6 publications below
• WB: See 12 publications below
• IHC: See 13 publications below
• IF: See 13 publications below
• IP: See 1 publications below
• CoIP: See 1 publications below

Product Information

16480-1-AP targets NDUFA4L2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9600

  Product name: Recombinant human NDUFA4L2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-87 aa of BC011910

  Sequence: MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF

• Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4-like 2
• Calculated Molecular Weight: 87 aa, 10 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC011910
• Gene Symbol: NDUFA4L2
• Gene ID (NCBI): 56901
• RRID: AB_2150637
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NRX3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NDUFA4L2(NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2), also named as NUOMS, is a HIF-1α target gene that localizes to the mitochondria and belongs to the complex I NDUFA4 subunit family. It downregulates oxygen consumption and Complex I activity in hypoxia. NDUFA4L2 is involved in hypoxic adaptation by decreasing mitochondrial ROS production.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Adv Sci (Weinh); Single-Cell Transcriptomic Analysis of Primary and Metastatic Tumor Ecosystems in Esophageal Squamous Cell Carcinoma; Authors - Yongxu Jia
human	WB	Cell Metab; Induction of the mitochondrial NDUFA4L2 protein by HIF-1α decreases oxygen consumption by inhibiting Complex I activity.; Authors - Daniel Tello ; KD Validated
human	WB,IHC,IF,IP	Ther Adv Med Oncol; NDUFA4L2 promotes trastuzumab resistance in HER2-positive breast cancer.; Authors - Yuan Yuan
mouse	IF	Sci Signal; Acute O2 sensing through HIF2α-dependent expression of atypical cytochrome oxidase subunits in arterial chemoreceptors.; Authors - Alejandro Moreno-Domínguez ; KO Validated
rat	WB	Basic Res Cardiol; Metabolic adaptation to chronic hypoxia in cardiac mitochondria.; Authors - Heather Lisa C LC
human,rat	WB	Nutrients; Diosgenin Inhibits ROS Generation by Modulating NOX4 and Mitochondrial Respiratory Chain and Suppresses Apoptosis in Diabetic Nephropathy; Authors - Yujie Zhong

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Josh (Verified Customer) (10-28-2021)

Clear, good signal at expected MW (10kDa) by western blot. Non specific bands at 50 and 70 kDa (and to a lesser extent, 15 and 100 kDa).

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: clear cell renal cell carcinoma cell line RCC4

NDUFA4L2 Antibody Western Blot validation (1:1000 dilution) in clear cell renal cell carcinoma cell line RCC4 (Cat no:16480-1-AP)

FH

Daniel (Verified Customer) (09-30-2019)

Kidney cancer mouse model stained for Ndufa4l2 (HRP detection by DAB stain).

• Applications: Immunohistochemistry,
• Primary Antibody Dilution: 1:200
• Cell Tissue Type: Mouse kidney (TRACK model)

NDUFA4L2 Antibody Immunohistochemistry, validation (1:200 dilution) in Mouse kidney (TRACK model) (Cat no:16480-1-AP)