Tested Applications
| Positive WB detected in | COLO 320 cells, HeLa cells, HUVEC cells, HepG2 cells, Jurkat clells, PC-3 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human liver cancer tissue, human kidney tissue, human liver tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
16480-1-AP targets NDUFA4L2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9600 Product name: Recombinant human NDUFA4L2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-87 aa of BC011910 Sequence: MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF Predict reactive species |
| Full Name | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4-like 2 |
| Calculated Molecular Weight | 87 aa, 10 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC011910 |
| Gene Symbol | NDUFA4L2 |
| Gene ID (NCBI) | 56901 |
| RRID | AB_2150637 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NRX3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NDUFA4L2(NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2), also named as NUOMS, is a HIF-1α target gene that localizes to the mitochondria and belongs to the complex I NDUFA4 subunit family. It downregulates oxygen consumption and Complex I activity in hypoxia. NDUFA4L2 is involved in hypoxic adaptation by decreasing mitochondrial ROS production.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NDUFA4L2 antibody 16480-1-AP | Download protocol |
| IHC protocol for NDUFA4L2 antibody 16480-1-AP | Download protocol |
| IP protocol for NDUFA4L2 antibody 16480-1-AP | Download protocol |
| WB protocol for NDUFA4L2 antibody 16480-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
NDUFA4L2 antibody (Cat# 16480-1-AP) has 38 citations published in journals including Nature, Cell Metabolism, Nature Communications, Oncogene, FASEB Journal, International Journal of Molecular Sciences, and Journal of Physiology. Research fields encompass mitochondrial biology, hypoxia/HIF-1α signaling, multiple cancers (renal, lung, gastric, breast, pancreatic, colorectal, osteosarcoma), neurology (CNS autoimmunity, retinopathy), cardiovascular disease, cellular metabolism, apoptosis, and epithelial-mesenchymal transition.
| Species | Application | Title |
|---|---|---|
Cell Metab Induction of the mitochondrial NDUFA4L2 protein by HIF-1α decreases oxygen consumption by inhibiting Complex I activity.
| ||
Nat Commun COXFA4L2 upregulation preserves residual cytochrome c oxidase activity in COXFA4-related Leigh-like encephalopathy.
| ||
Exp Mol Med Mitochondrial NDUFA4L2 attenuates the apoptosis of nucleus pulposus cells induced by oxidative stress via the inhibition of mitophagy. | ||
Adv Sci (Weinh) Single-Cell Transcriptomic Analysis of Primary and Metastatic Tumor Ecosystems in Esophageal Squamous Cell Carcinoma | ||
Cell Rep Med Personalized drug screening using patient-derived organoid and its clinical relevance in gastric cancer |
Reviews
What customers say
Users report clear, specific signal at the expected molecular weight (~10 kDa) in Western blot on HEPG2A and RCC4 cell lines, with one reviewer noting some non-specific bands at 50 and 70 kDa. Immunohistochemistry on a mouse kidney cancer model (TRACK) yielded good staining with DAB detection. Overall, the antibody performs well at dilutions of 1:200–1:1000 across WB and IHC applications, earning an average rating of 4.7 out of 5 stars.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Vignesh (Verified Customer) (11-18-2025) |
|
Josh (Verified Customer) (10-28-2021) | Clear, good signal at expected MW (10kDa) by western blot. Non specific bands at 50 and 70 kDa (and to a lesser extent, 15 and 100 kDa).
 |
Daniel (Verified Customer) (09-30-2019) | Kidney cancer mouse model stained for Ndufa4l2 (HRP detection by DAB stain).
 |
