NDUFA5 Polyclonal antibody

NDUFA5 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 16640-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

B13, CI 13KD B, CI-13kD-B, Complex I 13kD B, Complex I subunit B13

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, mouse brain tissue, rat brain tissue, Jurkat cells, mouse liver tissue
Positive IHC detected inmouse cerebellum tissue, human brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 10 publications below

Product Information

16640-1-AP targets NDUFA5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9995

Product name: Recombinant human NDUFA5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-116 aa of BC000813

Sequence: MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI

Predict reactive species
Full Name NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa
Calculated Molecular Weight 13 kDa
Observed Molecular Weight 13 kDa
GenBank Accession NumberBC000813
Gene Symbol NDUFA5
Gene ID (NCBI) 4698
RRIDAB_2251270
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ16718
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NDUFA5, also named as CI-13kD-B and NDUA5, belongs to the complex I NDUFA5 subunit family. It is accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which functions in the transfer of electrons from NADH to the respiratory chain. NDUFA5,an enrichment of mitochondrial protein, can be used as a mitochondrial marker protein(PMID:21360670).

Protocols

Product Specific Protocols
IF protocol for NDUFA5 antibody 16640-1-APDownload protocol
IHC protocol for NDUFA5 antibody 16640-1-APDownload protocol
WB protocol for NDUFA5 antibody 16640-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Mol Cell

Identification of TMEM126A as OXA1L-interacting protein reveals cotranslational quality control in mitochondria

Authors - Sabine Poerschke
humanWB

EMBO Rep

MITRAC15/COA1 promotes mitochondrial translation in a ND2 ribosome-nascent chain complex.

Authors - Cong Wang
humanWB

Cancer Lett

PMID: 29906487

Authors - Linhua Lan
humanWB

J Mol Biol

COA6 Facilitates Cytochrome c Oxidase Biogenesis as Thiol-reductase for Copper Metallochaperones in Mitochondria.

Authors - David Pacheu-Grau
humanWB

Proteomics

2-D DIGE analysis of the mitochondrial proteome from human skeletal muscle reveals time course-dependent remodelling in response to 14 consecutive days of endurance exercise training.

Authors - Egan Brendan B
humanWB

Evid Based Complement Alternat Med

Mechanistic Study of the Phytocompound, 2- β -D-Glucopyranosyloxy-1-hydroxytrideca-5,7,9,11-tetrayne in Human T-Cell Acute Lymphocytic Leukemia Cells by Using Combined Differential Proteomics and Bioinformatics Approaches.

Authors - Jeng-Yuan Shiau
Loading...
||
New chat Able
正在加载,请稍候...