NDUFA6 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NDUFA6 Polyclonal antibody, PBS Only (15445-1-PBS)

• 

  WB analysis of human heart using 15445-1-AP (same clone as 15445-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 15445-1-AP (NDUFA6 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15445-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 15445-1-AP (same clone as 15445-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15445-1-AP (NDUFA6 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15445-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 15445-1-AP (same clone as 15445-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 15445-1-AP (NDUFA6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15445-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 15445-1-AP (same clone as 15445-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 15445-1-AP (NDUFA6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15445-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 15445-1-AP (same clone as 15445-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 15445-1-AP (NDUFA6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15445-1-PBS in a different storage buffer formulation.

NDUFA6 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15445-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

15445-1-PBS targets NDUFA6 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7593

  Product name: Recombinant human NDUFA6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 4-128 aa of BC002772

  Sequence: SGVRQATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDITVKMGRDKVREMFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPRPKDFLSKFYVGHDP

• Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 6, 14kDa
• Calculated Molecular Weight: 15 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC002772
• Gene Symbol: NDUFA6
• Gene ID (NCBI): 4700
• RRID: AB_2267065
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P56556
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NDUFA6 (NADH:Ubiquinone Oxidoreductase Subunit A6), also called LYR motif-containing protein 6 (LYRM6), or Complex I-B14 (CI-B14), or NADH-ubiquinone oxidoreductase B14 subunit, is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). NDUFA6 participates in the regulation of adipogenic differentiation.