NDUFA9 Polyclonal antibody

• 

  WB analysis using 20312-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20312-1-AP (NDUFA9 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 20312-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20312-1-AP (NDUFA9 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse liver using 20312-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 20312-1-AP (NDUFA9 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 20312-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 20312-1-AP (NDUFA9 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse testis using 20312-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using NDUFA9 antibody (20312-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse testis using 20312-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using NDUFA9 antibody (20312-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse liver using 20312-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse liver tissue using NDUFA9 antibody (20312-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse liver using 20312-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse liver tissue using NDUFA9 antibody (20312-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

NDUFA9 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 20312-1-AP

Publications(26)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, ELISA

Synonyms

CI 39kD, CI-39kD, Complex I-39kD, NADH-ubiquinone oxidoreductase 39 kDa subunit, NDUFS2L

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse heart tissue, rat heart tissue
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 25 publications below
• IHC: See 1 publications below

Product Information

20312-1-AP targets NDUFA9 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, pig, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14150

  Product name: Recombinant human NDUFA9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-273 aa of BC009311

  Sequence: MAAAAQSRVVRVLSMSRSAITAIATSVCHGPPCRQLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKEAGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAIIVKPSDIFGREDRFLNSFASMHRFGPIPLGSLGWKTVKQPVYVVDVSKGIVNAVKDPDANGKSFAFVGPSRYLL

• Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa
• Calculated Molecular Weight: 377 aa, 43 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC009311
• Gene Symbol: NDUFA9
• Gene ID (NCBI): 4704
• RRID: AB_10694678
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16795
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NDUFA9(NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial) is also named as NDUFS2L, CI-39kD and belongs to the complex I NDUFA9 subunit family. It is involved in stabilizing the junction between membrane and matrix arms of complex I, a late assembly step critical for complex I biogenesis and activity.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; Hepatic micropeptide modulates mitochondrial RNA processing machinery in hepatocellular carcinoma; Authors - Linyu Zhu
mouse	WB	Research (Wash D C); LonP1 Links Mitochondria-ER Interaction to Regulate Heart Function; Authors - Yujie Li
human	WB	EMBO J; EglN2 associates with the NRF1-PGC1α complex and controls mitochondrial function in breast cancer.; Authors - Jing Zhang
mouse	WB	Dev Cell; Regulation of reverse electron transfer at mitochondrial complex I by unconventional Notch action in cancer stem cells.; Authors - Rani Ojha
human	WB	J Cell Biol; FAM92A1 is a BAR domain protein required for mitochondrial ultrastructure and function.; Authors - Liang Wang
human	WB	Cell Mol Life Sci; GTPBP8 is required for mitoribosomal biogenesis and mitochondrial translation; Authors - Liang Wang