NDUFB10 Polyclonal antibody

• 

  WB analysis of HepG2 using 15589-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15589-1-AP (NDUFB10 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human skeletal muscle using 15589-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15589-1-AP (NDUFB10 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 15589-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 15589-1-AP (NDUFB10 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 15589-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15589-1-AP (NDUFB10 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 15589-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15589-1-AP (NDUFB10 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 15589-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 15589-1-AP (NDUFB10 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 15589-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 15589-1-AP (NDUFB10 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 15589-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 15589-1-AP (NDUFB10 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 15589-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 15589-1-AP (NDUFB10 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 15589-1-AP

  IP result of anti-NDUFB10 (IP:15589-1-AP, 4ug; Detection:15589-1-AP 1:1000) with HepG2 cells lysate 1000ug.

• 

  IHC staining of human ovary cancer using 15589-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 15589-1-AP (NDUFB10 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary using 15589-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary tissue slide using 15589-1-AP (NDUFB10 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human kidney using 15589-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 15589-1-AP (NDUFB10 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human kidney using 15589-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 15589-1-AP (NDUFB10 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human heart using 15589-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 15589-1-AP (NDUFB10 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human heart using 15589-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 15589-1-AP (NDUFB10 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human kidney using 15589-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 15589-1-AP (NDUFB10 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human kidney using 15589-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 15589-1-AP (NDUFB10 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human placenta using 15589-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 15589-1-AP (NDUFB10 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human placenta using 15589-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 15589-1-AP (NDUFB10 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human skin using 15589-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 15589-1-AP (NDUFB10 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human skin using 15589-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 15589-1-AP (NDUFB10 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human brain using 15589-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 15589-1-AP (NDUFB10 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human brain using 15589-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 15589-1-AP (NDUFB10 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human spleen using 15589-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 15589-1-AP (NDUFB10 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human spleen using 15589-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 15589-1-AP (NDUFB10 antibody) at dilution of 1:50 (under 40x lens).

• Featured Product
• KD/KO Validated

NDUFB10 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 15589-1-AP

Publications(9)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

PDSW, NADH-ubiquinone oxidoreductase PDSW subunit, Complex I-PDSW, Complex I PDSW, CI-PDSW

---

Tested Applications

• Positive WB detected in: HepG2 cells, human skeletal muscle tissue, mouse liver tissue
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human ovary cancer tissue, human brain tissue, human heart tissue, human kidney tissue, human ovary tissue, human placenta tissue, human skin tissue, human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 9 publications below

Product Information

15589-1-AP targets NDUFB10 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7922

  Product name: Recombinant human NDUFB10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-172 aa of BC005829

  Sequence: MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHRQYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS

• Full Name: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC005829
• Gene Symbol: NDUFB10
• Gene ID (NCBI): 4716
• RRID: AB_2150790
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O96000
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NDUFB10(NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10) is also named as PDSW and belongs to the complex I NDUFB10 subunit family. It is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. The Complex I functions in the transfer of electrons from NADH to the respiratory chain.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Stem Cell; LIN28 Regulates Stem Cell Metabolism and Conversion to Primed Pluripotency.; Authors - Jin Zhang
human	WB	Nat Cell Biol; LIN28 phosphorylation by MAPK/ERK couples signalling to the post-transcriptional control of pluripotency.; Authors - Kaloyan M Tsanov
human	WB	Mol Cell; Identification of TMEM126A as OXA1L-interacting protein reveals cotranslational quality control in mitochondria; Authors - Sabine Poerschke
human	WB	Proc Natl Acad Sci U S A; Assembly factors for the membrane arm of human complex I.; Authors - Andrews Byron B
human	WB	Cell Rep; A Role for Mitochondrial Translation in Promotion of Viability in K-Ras Mutant Cells.; Authors - Timothy D Martin ; KO Validated
mouse	WB	Front Endocrinol (Lausanne); GIT2 Acts as a Systems-Level Coordinator of Neurometabolic Activity and Pathophysiological Aging.; Authors - Bronwen Martin