Featured Product
KD/KO Validated

NDUFB10 Polyclonal antibody

NDUFB10 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 15589-1-AP

Publications (10)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

CI PDSW, CI-PDSW, Complex I PDSW, Complex I-PDSW, NADH-ubiquinone oxidoreductase PDSW subunit

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIPIHC

WB analysis of HepG2 using 15589-1-AP
HepG2 cells were subjected to SDS PAGE followed by western blot with 15589-1-AP (NDUFB10 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of human skeletal muscle using 15589-1-AP
human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15589-1-AP (NDUFB10 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse liver using 15589-1-AP
mouse liver tissue were subjected to SDS PAGE followed by western blot with 15589-1-AP (NDUFB10 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse liver using 15589-1-AP
mouse liver tissue were subjected to SDS PAGE followed by western blot with 15589-1-AP (NDUFB10 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HepG2 using 15589-1-AP
HepG2 cells were subjected to SDS PAGE followed by western blot with 15589-1-AP (NDUFB10 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HepG2 using 15589-1-AP
HepG2 cells were subjected to SDS PAGE followed by western blot with 15589-1-AP (NDUFB10 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse liver using 15589-1-AP
mouse liver tissue were subjected to SDS PAGE followed by western blot with 15589-1-AP (NDUFB10 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse liver using 15589-1-AP
mouse liver tissue were subjected to SDS PAGE followed by western blot with 15589-1-AP (NDUFB10 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse liver using 15589-1-AP
mouse liver tissue were subjected to SDS PAGE followed by western blot with 15589-1-AP (NDUFB10 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of HepG2 using 15589-1-AP
IP result of anti-NDUFB10 (IP:15589-1-AP, 4ug; Detection:15589-1-AP 1:1000) with HepG2 cells lysate 1000ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human heart using 15589-1-AP
Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 15589-1-AP (NDUFB10 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human stomach cancer using 15589-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 15589-1-AP (NDUFB10 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse stomach using 15589-1-AP
Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 15589-1-AP (NDUFB10 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat heart using 15589-1-AP
Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 15589-1-AP (NDUFB10 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat stomach using 15589-1-AP
Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 15589-1-AP (NDUFB10 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary cancer using 15589-1-AP
Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 15589-1-AP (NDUFB10 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human kidney using 15589-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 15589-1-AP (NDUFB10 Antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human kidney using 15589-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 15589-1-AP (NDUFB10 Antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human ovary using 15589-1-AP
Immunohistochemical analysis of paraffin-embedded human ovary tissue slide using 15589-1-AP (NDUFB10 Antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human heart using 15589-1-AP
Immunohistochemical analysis of paraffin-embedded human heart using 15589-1-AP (NDUFB10 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human heart using 15589-1-AP
Immunohistochemical analysis of paraffin-embedded human heart using 15589-1-AP (NDUFB10 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human kidney using 15589-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney using 15589-1-AP (NDUFB10 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human kidney using 15589-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney using 15589-1-AP (NDUFB10 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human placenta using 15589-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta using 15589-1-AP (NDUFB10 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human placenta using 15589-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta using 15589-1-AP (NDUFB10 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human skin using 15589-1-AP
Immunohistochemical analysis of paraffin-embedded human skin using 15589-1-AP (NDUFB10 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human skin using 15589-1-AP
Immunohistochemical analysis of paraffin-embedded human skin using 15589-1-AP (NDUFB10 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human brain using 15589-1-AP
Immunohistochemical analysis of paraffin-embedded human brain using 15589-1-AP (NDUFB10 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human brain using 15589-1-AP
Immunohistochemical analysis of paraffin-embedded human brain using 15589-1-AP (NDUFB10 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human spleen using 15589-1-AP
Immunohistochemical analysis of paraffin-embedded human spleen using 15589-1-AP (NDUFB10 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human spleen using 15589-1-AP
Immunohistochemical analysis of paraffin-embedded human spleen using 15589-1-AP (NDUFB10 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NDUFB10 in ?

Overview

Tested Applications
Product Information
Publications (10)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HepG2 cells, human skeletal muscle tissue, mouse liver tissue
Positive IP detected in	HepG2 cells
Positive IHC detected in	human ovary cancer tissue, human kidney tissue, human spleen tissue, human skin tissue, rat stomach tissue, human placenta tissue, human heart tissue, rat heart tissue, mouse stomach tissue, human ovary tissue, human brain tissue, human stomach cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15589-1-AP targets NDUFB10 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag7922 Product name: Recombinant human NDUFB10 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-172 aa of BC005829 Sequence: MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHRQYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS Predict reactive species
Full Name	NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa
Calculated Molecular Weight	22 kDa
Observed Molecular Weight	22 kDa
GenBank Accession Number	BC005829
Gene Symbol	NDUFB10
Gene ID (NCBI)	4716
RRID	AB_2150790
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O96000
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NDUFB10(NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10) is also named as PDSW and belongs to the complex I NDUFB10 subunit family. It is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. The Complex I functions in the transfer of electrons from NADH to the respiratory chain.

Protocols

Product Specific Protocols
IHC protocol for NDUFB10 antibody 15589-1-AP	Download protocol
IP protocol for NDUFB10 antibody 15589-1-AP	Download protocol
WB protocol for NDUFB10 antibody 15589-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The NDUFB10 Polyclonal antibody (Cat# 15589-1-AP) has 10 citations. These appear in journals including Cell Stem Cell, Nature Cell Biology, Molecular Cell, PNAS, Cell Reports, Chinese Journal of Cancer Research, Frontiers in Endocrinology, Aging, Frontiers in Aging Neuroscience, and Brain Pathology. The research fields span stem cell biology, mitochondrial respiration and complex I assembly, aging and thymic dysfunction, neurodegeneration (Parkinson's disease), and lung adenocarcinoma. All cited applications are Western blot in human and mouse samples.

Species	Application	Title
mouse	WB	Cell Stem Cell LIN28 Regulates Stem Cell Metabolism and Conversion to Primed Pluripotency. Authors - Jin Zhang View Article
human	WB	Nat Cell Biol LIN28 phosphorylation by MAPK/ERK couples signalling to the post-transcriptional control of pluripotency. Authors - Kaloyan M Tsanov View Article
human	WB	Mol Cell Identification of TMEM126A as OXA1L-interacting protein reveals cotranslational quality control in mitochondria Authors - Sabine Poerschke View Article
human	WB	Proc Natl Acad Sci U S A Assembly factors for the membrane arm of human complex I. Authors - Andrews Byron B View Article
human	WB	Cell Rep A Role for Mitochondrial Translation in Promotion of Viability in K-Ras Mutant Cells. Authors - Timothy D Martin KO Validated View Article
human	WB	Chin J Cancer Res Molecular subtypes and prognostic signature rooted in disulfidptosis highlight tumor microenvironment in lung adenocarcinoma. Authors - Xia Wei View Article