NDUFB3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NDUFB3 Polyclonal antibody (12358-1-AP)

NDUFB3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12358-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

B12, CI B12, CI-B12, Complex I B12, Complex I-B12

• 

  WB analysis of human heart using 12358-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 12358-1-AP (NDUFB3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 12358-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12358-1-AP (NDUFB3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 12358-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12358-1-AP (NDUFB3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 12358-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12358-1-AP (NDUFB3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 12358-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 12358-1-AP (NDUFB3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 12358-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 12358-1-AP (NDUFB3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NDUFB3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HL-60 cells, human heart tissue, HeLa cells, Ramos cells, mouse heart tissue, rat heart tissue
• Positive IHC detected in: human liver cancer tissue, human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12358-1-AP targets NDUFB3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3022

  Product name: Recombinant human NDUFB3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-98 aa of BC018183

  Sequence: MAHEHGHEHGHHKMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKSVSFSDVFFKGFKWGFAAFVVAVGAEYYLESLNKDKKHH

• Full Name: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 3, 12kDa
• Calculated Molecular Weight: 98 aa, 11 kDa
• Observed Molecular Weight: 11 kDa
• GenBank Accession Number: BC018183
• Gene Symbol: NDUFB3
• Gene ID (NCBI): 4709
• RRID: AB_2282633
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43676
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NDUFB3(NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3) is also named as CI-B12 and belongs to the complex I NDUFB3 subunit family.It is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis.

Publications

What published studies show

The NDUFB3 Polyclonal antibody (Cat# 12358-1-AP) has 2 total citations. These appear in Journal of Hazardous Materials and International Journal of Biological Macromolecules. The cited research spans environmental toxicology (maternal E551 exposure effects on DNA methylation and metabolic disorders) and nanomedicine for gastroenterology (chitosan-gold nanoparticles for ulcerative colitis therapy). Both studies used the antibody in Western blot applications with mouse samples.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Hazard Mater; Maternal exposure to E 551 during pregnancy leads to genome-wide DNA methylation changes and metabolic disorders in the livers of pregnant mice and their fetuses; Authors - Yingqi Zhan
mouse	WB	Int J Biol Macromol; Colon-targeted chitosan-gold nanoparticles loaded with Pueraria flavonoids for ulcerative colitis therapy via barrier repair and immune modulation.; Authors - Xing-Yue Xu