Tested Applications
| Positive WB detected in | mouse ovary tissue, MCF-7 cells, mouse brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human brain tissue, mouse liver tissue, human brain tissue, human heart tissue, human placenta tissue, rat heart tissue, human testis tissue, human lung tissue, rat stomach tissue, human liver tissue, human cervical cancer tissue, human stomach cancer tissue, human kidney tissue, mouse stomach tissue, human spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14912-1-AP targets NDUFB7 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6709 Product name: Recombinant human NDUFB7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-137 aa of BC002595 Sequence: MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL Predict reactive species |
| Full Name | NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa |
| Calculated Molecular Weight | 16 kDa |
| Observed Molecular Weight | 18-22 kDa |
| GenBank Accession Number | BC002595 |
| Gene Symbol | NDUFB7 |
| Gene ID (NCBI) | 4713 |
| RRID | AB_2235903 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P17568 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NDUFB7(NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7) is also named as CI-B18 and belongs to the complex I NDUFB7 subunit family. It is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which couples the oxidation of NADH to the reduction of ubiquinone and the translocation of protons across the inner membrane. NDUFB7 protein lacks a mitochondrial targeting signal and transmembrane domains. However, it has a Cx(9)C motif that includes an intermembrane space targeting signal.(PMID:21310150).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for NDUFB7 antibody 14912-1-AP | Download protocol |
| IP protocol for NDUFB7 antibody 14912-1-AP | Download protocol |
| WB protocol for NDUFB7 antibody 14912-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The NDUFB7 Polyclonal antibody (Cat# 14912-1-AP) has 12 citations published in journals including Cell, Redox Biology, Cell Death & Disease, Molecular Medicine, Cell Reports, EMBO Reports, iScience, Journal of Biological Chemistry, Molecular Metabolism, Ecotoxicology and Environmental Safety, Cell Reports Methods, and Heliyon. Research fields span mitochondrial complex I biology, oxidative metabolism, neurodegeneration, myopathy, aging, apoptosis, retinal vascular biology, ciliopathy, and mRNA processing.
| Species | Application | Title |
|---|---|---|
Cell A transmitochondrial sodium gradient controls membrane potential in mammalian mitochondria | ||
Redox Biol Loss of cardiac mitochondrial complex I persulfidation impairs NAD+ homeostasis in aging | ||
Mol Med Altered redox mitochondrial biology in the neurodegenerative disorder fragile X-tremor/ataxia syndrome: use of antioxidants in precision medicine. | ||
Cell Rep A membrane arm of mitochondrial complex I sufficient to promote respirasome formation. | ||
Ecotoxicol Environ Saf Proteomic analysis reveals that cigarette smoke exposure diminishes ovarian reserve in mice by disrupting the CREB1-mediated ovarian granulosa cell proliferation-apoptosis balance |
