NDUFS2 Polyclonal antibody

• 

  WB analysis using 28125-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28125-1-AP (NDUFS2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse skeletal muscle using 28125-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 28125-1-AP (NDUFS2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 28125-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 28125-1-AP (NDUFS2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 28125-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using NDUFS2 antibody (28125-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  IF Staining of HepG2 using 28125-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using NDUFS2 antibody (28125-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

NDUFS2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 28125-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CI 49kD, CI-49kD, Complex I 49kD, Complex I-49kD, EC:7.1.1.2

---

Tested Applications

• Positive WB detected in: Jurkat cells, mouse skeletal muscle tissue, rat skeletal muscle tissue
• Positive IHC detected in: mouse skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28125-1-AP targets NDUFS2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27078

  Product name: Recombinant human NDUFS2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 119-464 aa of BC000170

  Sequence: GTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIRPPPRAQWIRVLFGEITRLLNHIMAVTTHALDLGAMTPFFWLFEEREKMFEFYERVSGARMHAAYIRPGGVHQDLPLGLMDDIYQFSKNFSLRLDELEELLTNNRIWRNRTIDIGVVTAEEALNYGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFDVPVGSRGDCYDRYLCRVEEMRQSLRIIAQCLNKMPPGEIKVDDAKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPYRCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIVFGEVDR

• Full Name: NADH dehydrogenase (ubiquinone) Fe-S protein 2, 49kDa (NADH-coenzyme Q reductase)
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 40-50 kDa
• GenBank Accession Number: BC000170
• Gene Symbol: NDUFS2
• Gene ID (NCBI): 4720
• RRID: AB_3669645
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75306
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NDUFS2 (NADH:Ubiquinone Oxidoreductase Core Subunit S2) is a crucial nuclear-encoded protein component of mitochondrial complex I (NADH dehydrogenase), the first and largest complex in the mitochondrial electron transport chain. It functions as part of the enzyme's core matrix arm, directly contributing to the oxidation of NADH, the transfer of electrons to ubiquinone, and the coupled translocation of protons across the inner mitochondrial membrane, which is essential for ATP synthesis.