NDUFS3 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  WB analysis using 86676-1-RR (same clone as 86676-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86676-1-RR (NDUFS3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86676-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 86676-1-RR (same clone as 86676-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using NDUFS3 antibody (86676-1-RR, Clone: 251654E6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86676-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP02593-1

  The mean NDUFS3 concentration was determined to be 89.8 ng/mL in HEK-293T cell extract based on a 1.3 mg/mL extract load, 74.3 ng/mL in HepG2 cell extract based on a 1.2 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02593-1

  Cytometric bead array standard curve of MP02593-1, NDUFS3 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 86676-2-PBS. Detection antibody: 86676-1-PBS. Standard: Ag7072. Range: 0.781-100 ng/mL.

• 

  Affinity and Kinetic Characterization of 86676-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86676-1-RR against Human NDUFS3 were performed. The affinity constant is below 1 pM.

• KD/KO Validated

NDUFS3 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 86676-1-PBS

Clone No.251654E6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

Synonyms

CI 30kD, CI30kD, CI-30kD, Complex I-30kD, EC:7.1.1.2

---

Product Information

86676-1-PBS targets NDUFS3 as part of a matched antibody pair:

MP02593-1: 86676-2-PBS capture and 86676-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7072

  Product name: Recombinant human NDUFS3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-264 aa of BC000617

  Sequence: MAAAAVARLWWRGILGASALTRGTGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK

• Full Name: NADH dehydrogenase (ubiquinone) Fe-S protein 3, 30kDa (NADH-coenzyme Q reductase)
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC000617
• Gene Symbol: NDUFS3
• Gene ID (NCBI): 4722
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75489
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NDUFS3(NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial) is also named as CI-30kD and belongs to the complex I 30 kDa subunit family. It catalyzes the oxidation of NADH, with the concomitant reduction of ubiquinone and ejection of protons out of the mitochondria(PMID:10967146). NDUFS3 can be used as a mitochondrial matrix control(PMID:17344420).