Product Information
68329-4-PBS targets NDUFS6 as part of a matched antibody pair:
MP50662-2: 68329-4-PBS capture and 68329-5-PBS detection (validated in Cytometric bead array)
MP50662-3: 68329-4-PBS capture and 68329-6-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6286 Product name: Recombinant human NDUFS6 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-124 aa of BC046155 Sequence: MAAAMTFCRLLNRCGEAARSLPLGARCFGVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH Predict reactive species |
| Full Name | NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Q reductase) |
| Calculated Molecular Weight | 14 kDa |
| GenBank Accession Number | BC046155 |
| Gene Symbol | NDUFS6 |
| Gene ID (NCBI) | 4726 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G Magarose purification |
| UNIPROT ID | O75380 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
