NDUFS7 Polyclonal antibody

• 

  WB analysis of A549 using 15728-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 15728-1-AP (NDUFS7 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 15728-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 15728-1-AP (NDUFS7 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 15728-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 15728-1-AP (NDUFS7 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human liver using 15728-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 15728-1-AP (NDUFS7 antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of HeLa using 15728-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using NDUFS7 antibody (15728-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

NDUFS7 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 15728-1-AP

Publications(16)

Reviews (3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

PSST, NADH-ubiquinone oxidoreductase 20 kDa subunit, NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial, EC:7.1.1.2, Complex I-20kD

---

Tested Applications

• Positive WB detected in: A549 cells, human brain tissue, Hela cells
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 13 publications below
• IHC: See 2 publications below
• IF: See 3 publications below
• IP: See 1 publications below

Product Information

15728-1-AP targets NDUFS7 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8471

  Product name: Recombinant human NDUFS7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-213 aa of BC005954

  Sequence: MAVLSAPGLRGFRILGLRSSVGLAVQARGVHQSVATDGPSSTQPALPKARAVAPKPSSRGEYVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGILQLQRKIKRERRLQIWYRR

• Full Name: NADH dehydrogenase (ubiquinone) Fe-S protein 7, 20kDa (NADH-coenzyme Q reductase)
• Calculated Molecular Weight: 213 aa, 24 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC005954
• Gene Symbol: NDUFS7
• Gene ID (NCBI): 374291
• RRID: AB_2149029
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75251
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NDUFS7(NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial) protein is one of the most conserved subunits of mitochondrial respiratory chain complex I and plays a central role in the interaction with the electron acceptor ubiquinone and in the proton-translocating mechanism(PMID:15269216).Defects in NDUFS7 are a cause of Leigh syndrome (LS) and mitochondrial complex I deficiency (MT-C1D).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Res; NDUFAB1 confers cardio-protection by enhancing mitochondrial bioenergetics through coordination of respiratory complex and supercomplex assembly.; Authors - Tingting Hou
human	WB	Mol Cell; Maintaining Iron Homeostasis Is the Key Role of Lysosomal Acidity for Cell Proliferation.; Authors - Ross A Weber
human	WB	Cell Chem Biol; Metabolic targeting of cancer by a ubiquinone uncompetitive inhibitor of mitochondrial complex I.; Authors - Shashi Jain
mouse	WB	Arch Toxicol; SIRT3-dependent mitochondrial redox homeostasis mitigates CHK1 inhibition combined with gemcitabine treatment induced cardiotoxicity in hiPSC-CMs and mice; Authors - Jia-Wen Chen
human	IF	Mol Cell Biol; TRMT1-catalyzed tRNA modifications are required for redox homeostasis to ensure proper cellular proliferation and oxidative stress survival.; Authors - Joshua M Dewe
human	WB	FEBS J; Human brain proteins showing neuron-specific interactions with γ-secretase.; Authors - Mitsuhiro Inoue

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Matthieu (Verified Customer) (09-24-2025)

Band visible at expected size

• Applications: Western Blot
• Primary Antibody Dilution: 1/1000
• Cell Tissue Type: human fibroblasts

FH

Manon (Verified Customer) (09-23-2025)

Good specific band

• Applications: Western Blot
• Primary Antibody Dilution: 1/1000
• Cell Tissue Type: Fibroblasts

FH

Emilie (Verified Customer) (07-23-2025)

Used for Western blot on human fibroblasts and gives a clear, well-defined band. I recommend this product.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Fibroblasts