NDUFV1 Monoclonal antibody, PBS Only

• 

  WB analysis using 68144-1-Ig (same clone as 68144-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68144-1-Ig (NDUFV1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68144-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68144-1-Ig (same clone as 68144-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68144-1-Ig (NDUFV1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68144-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68144-1-Ig (same clone as 68144-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68144-1-Ig (NDUFV1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68144-1-PBS in a different storage buffer formulation.

• 

  WB analysis of 4T1 using 68144-1-Ig (same clone as 68144-1-PBS)

  4T1 cells were subjected to SDS PAGE followed by western blot with 68144-1-Ig (NDUFV1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68144-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 68144-1-Ig (same clone as 68144-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 68144-1-Ig (NDUFV1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68144-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 68144-1-Ig (same clone as 68144-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 68144-1-Ig (NDUFV1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68144-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 68144-1-Ig (same clone as 68144-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 68144-1-Ig (NDUFV1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68144-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 68144-1-Ig (same clone as 68144-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 68144-1-Ig (NDUFV1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68144-1-PBS in a different storage buffer formulation.

NDUFV1 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 68144-1-PBS

Clone No.3E9D4

Host / Isotype

Mouse / IgG2a

Reactivity

Human, pig, rabbit, rat, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

CI 51kD, Complex I 51kD, NDUFV1, UQOR1

---

Product Information

68144-1-PBS targets NDUFV1 in WB, IHC, Indirect ELISA applications and shows reactivity with Human, pig, rabbit, rat, mouse samples.

• Tested Reactivity: Human, pig, rabbit, rat, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32659

  Product name: Recombinant human NDUFV1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 116-447 aa of BC015645

  Sequence: NADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAGLIGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNHPCTVEEEMSVPLKELIEKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALVQAQTGLGTAAVIVMDRSTDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELE

• Full Name: NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa
• Calculated Molecular Weight: 51 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC015645
• Gene Symbol: NDUFV1
• Gene ID (NCBI): 4723
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P49821
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DUFV1(NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial) is also named as UQOR1,Complex I-51kD and belongs to the complex I 51 kDa subunit family. It is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. It has 2 isoforms produced by alternative splicing. Defects in NDUFV1 are a cause of Leigh syndrome (LS) and mitochondrial complex I deficiency (MT-C1D).