NECAB3 Polyclonal antibody

• 

  WB analysis of human brain using 18940-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 18940-1-AP (NECAB3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 18940-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 18940-1-AP (NECAB3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 18940-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 18940-1-AP (NECAB3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human pancreas using 18940-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas using 18940-1-AP (NECAB3 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human pancreas using 18940-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas using 18940-1-AP (NECAB3 antibody) at dilution of 1:100 (under 40x lens).

NECAB3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 18940-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

APBA2BP, EFCBP3, NECAB3, Nek2 interacting protein 1, NIP1, STIP3, SYTIP2, X11L binding protein 51, XB51

---

Tested Applications

• Positive WB detected in: human brain tissue, rat brain tissue
• Positive IHC detected in: human pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

18940-1-AP targets NECAB3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13493

  Product name: Recombinant human NECAB3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-362 aa of BC047673

  Sequence: MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADKNDDGKLSFEEFQNYFADGVLSLGELQELFSGIDGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAVLAAMDATKLEYERASKVDQFVTRFLLRETVSQLQALQSSLEGASDTLEAQAHGWRSDAESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQVNRLQELIDQLECKAPRLEPLREEDLAKGPDLHILMAQRQVQVAEEGLQDFHRALRCYVDFTGAQSHCLHVSAQKMLDGASFTLYEFWQDEASWRRHQQSPGSKAFQRILIDHLRAPDTLTTVFFPASWWIMNNN

• Full Name: N-terminal EF-hand calcium binding protein 3
• Calculated Molecular Weight: 362aa,41 kDa; 396aa,44 kDa
• Observed Molecular Weight: 40-44 kDa
• GenBank Accession Number: BC047673
• Gene Symbol: NECAB3
• Gene ID (NCBI): 63941
• RRID: AB_10596622
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96P71
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NECAB3, also named as APBA2BP, NIP1, SYTIP2 and XB51, is a potential substrate of Nek2. NECAB3 inhibits the interaction of APBA2 with beta-amyloid precursor protein (APP). NECAB3 has three isoforms with MW 40 kDa, 44 kDa and 22 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	PLoS One; Amyloidosis, Synucleinopathy, and Prion Encephalopathy in a Neuropathic Lysosomal Storage Disease: The CNS-Biomarker Potential of Peripheral Blood.; Authors - Naughton Bartholomew J BJ