NECAP2 Polyclonal antibody

• 

  WB analysis of MCF-7 using 15899-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 15899-1-AP (NECAP2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 15899-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15899-1-AP (NECAP2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse cerebellum using 15899-1-AP

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 15899-1-AP (NECAP2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human liver using 15899-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 15899-1-AP (NECAP2 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human liver using 15899-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 15899-1-AP (NECAP2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

NECAP2 Polyclonal Antibody for WB, ELISA

Cat No. 15899-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

NECAP 2, NECAP endocytosis associated 2, NECAP2

---

Tested Applications

• Positive WB detected in: MCF7 cells, HeLa cells, human liver tissue, mouse cerebellum tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

15899-1-AP targets NECAP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8721

  Product name: Recombinant human NECAP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-263 aa of BC018914

  Sequence: MEESGYESVLCVKPDVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQNPDQGPKLDLGFKEGQTIKLNIANMKKKEGAAGNPRVRPASTGGLSLLPPPPGGKTSTLIPPPGEQLAVGGSLVQPAVAPSSGGAPVPWPQPNPATADIWGDFTKSTGSTSSQTQPGTGWVQF

• Full Name: NECAP endocytosis associated 2
• Calculated Molecular Weight: 263 aa, 28 kDa
• Observed Molecular Weight: 35-37 kDa
• GenBank Accession Number: BC018914
• Gene Symbol: NECAP2
• Gene ID (NCBI): 55707
• RRID: AB_2149187
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NVZ3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Oxid Med Cell Longev; Comprehensive Prognostic Analysis of Immune Implication Value and Oxidative Stress Significance of NECAP2 in Low-Grade Glioma; Authors - Zhichao Lu