NEK2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NEK2 Polyclonal antibody (14233-1-AP)

• Featured Product
• KD/KO Validated

NEK2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 14233-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

EC:2.7.11.1, HSPK 21, HsPK21, NEK2A, Never in mitosis A-related kinase 2

• 

  WB analysis using 14233-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14233-1-AP (NEK2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 14233-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 14233-1-AP (NEK2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 14233-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 14233-1-AP (NEK2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 14233-1-AP

  Immunohistochemical analysis of paraffin-embedded skin cancer slide using 14233-1-AP (NEK2 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 14233-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 14233-1-AP (NEK2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 14233-1-AP

  Immunofluorescent analysis of Hela cells, using NEK2 antibody 14233-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HEK-293T cells, K-562 cells, Jurkat cells
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: Hela cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14233-1-AP targets NEK2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5474

  Product name: Recombinant human NEK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-362 aa of BC043502

  Sequence: MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLIADLVADEQRRNLERRGRQLGEPEKSQDSSPVLSELKLKEIQLQERERALKAREERLEQKEQELCVRERLAEDKLARAENLLKNYSLLKERK

• Full Name: NIMA (never in mitosis gene a)-related kinase 2
• Calculated Molecular Weight: 52 kDa
• Observed Molecular Weight: 45-52 kDa
• GenBank Accession Number: BC043502
• Gene Symbol: NEK2
• Gene ID (NCBI): 4751
• RRID: AB_2150373
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P51955
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Cell Int; Overexpressed NEK2 contributes to progression and cisplatin resistance through activating the Wnt/β-catenin signaling pathway in cervical cancer; Authors - Jiang Haiye ; KD Validated
human	WB	Nucleic Acids Res; The TRIM69-MST2 signaling axis regulates centrosome dynamics and chromosome segregation; Authors - Yilin Wang
human	IF	Science; The mechanism of acentrosomal spindle assembly in human oocytes; Authors - Tianyu Wu