NEK3 Polyclonal antibody

• 

  WB analysis of SH-SY5Y using 12843-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 12843-1-AP (NEK3 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IF Staining of SH-SY5Y using 12843-1-AP

  Immunofluorescent analysis of (-20℃ Acetone) fixed SH-SY5Y cells using 12843-1-AP (NEK3 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

NEK3 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 12843-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

NimA-related protein kinase 3, NimA related protein kinase 3, Never in mitosis A-related kinase 3, HSPK36, HSPK 36

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

12843-1-AP targets NEK3 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3856

  Product name: Recombinant human NEK3 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-300 aa of BC019916

  Sequence: MDDYMVLRMIGEGSFGRALLVQHESSNQMFAMKEIRLPKSFSNTQNSRKEAVLLAKMKHPNIVAFKESFEAEGHLYIVMEYCDGGDLMQKIKQQKGKLFPEDMILNWFTQMCLGVNHIHKKRVLHRDIKSKNIFLTQNGKVKLGDFGSARLLSNPMAFACTYVGTPYYVPPEIWENLPYNNKSDIWSLGCILYELCTLKHPFQANSWKNLILKVCQGCISPLPSHYSYELQFLVKQMFKRNPSHRPSATTLLSRGIVARLVQKCLPPEIIMEYGEEVLEEIKNSKHNTPRKKTNPSRIRI

• Full Name: NIMA (never in mitosis gene a)-related kinase 3
• Calculated Molecular Weight: 506 aa, 58 kDa
• Observed Molecular Weight: 52-60 kDa
• GenBank Accession Number: BC019916
• Gene Symbol: NEK3
• Gene ID (NCBI): 4752
• RRID: AB_2877888
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P51956
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Cancers (Basel); Differential Expression of NEK Kinase Family Members in Esophageal Adenocarcinoma and Barrett's Esophagus; Authors - Lei Chen