• Featured Product
  • KD/KO Validated

NEK6 Polyclonal antibody

NEK6 Polyclonal Antibody for WB, IF/ICC, ELISA
Cat No. 10378-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, monkey

Applications

WB, IHC, IF/ICC, ELISA

EC:2.7.11.34, Never in mitosis A-related kinase 6, NimA related protein kinase 6, NimA-related protein kinase 6, Protein kinase SID6 1512

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HT-1080 cells, HeLa cells
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:300-1:1200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10378-1-AP targets NEK6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.

Tested Reactivity human, mouse, rat, monkey
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0266

Product name: Recombinant human NEK6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 6-209 aa of BC000101

Sequence: GHMPHGGSSNNLCHTLGPVHPPDPQRHPNTLSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSETTAAHSLVG

Predict reactive species
Full Name NIMA (never in mitosis gene a)-related kinase 6
Calculated Molecular Weight 35 kDa
Observed Molecular Weight 35-45 kDa
GenBank Accession NumberBC000101
Gene Symbol NEK6
Gene ID (NCBI) 10783
RRIDAB_2251272
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9HC98
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The Aspergillus nidulans 'never in mitosis A' (NIMA) is a serine/ threonine kinase that controls initiation of mitosis, whereas its inactivation is necessary for mitotic exit. NIMA-related kinases (NEKs) are a group of protein kinases that are homologous to NIMA. Evidence suggests that NEKs perform functions similar to those of NIMA. Human NIMA-related kinase 6 (NEK6, synonym: SID6-1512) is comprised of 338 amino acids and shows both nuclear and cytoplasmic localizations in HeLa cells. NEK6 is required for mitotic progression of human cells. NEK6 is phosphorylated and activated during M phase. Inhibition of Nek6 function by either overexpression of an inactive Nek6 mutant or elimination of endogenous Nek6 by siRNA arrests cells in M phase and triggers apoptosis. Recombinant human NEK6 protein produced in insect cells effectively phosphorylates histones H1 and H3, but not casein. Thus, these results suggest that, unlike other mammalian NIMA-related kinases, NEK6 is a mitotic histone kinase which regulates chromatin condensation in mammalian cells. NEK6 transcripts are ubiquitously expressed with the highest expression found in the heart and skeletal muscle, and the hNek6 gene is localized to human chromosome 9q33-34. NEK6 has four isoforms with MW 35-40 kDa.

Protocols

Product Specific Protocols
WB protocol for NEK6 antibody 10378-1-APDownload protocol
IF protocol for NEK6 antibody 10378-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Front Mol Biosci

LncRNA FAM13A-AS1 Promotes Renal Carcinoma Tumorigenesis Through Sponging miR-141-3p to Upregulate NEK6 Expression.

Authors - Xin Jun Wang
humanWB

J Oncol

MicroRNA-323a-3p Negatively Regulates NEK6 in Colon Adenocarcinoma Cells.

Authors - Zhongshi Hong
humanWB,IHC

J Cancer

NEK6 functions as an oncogene to promote the proliferation and metastasis of ovarian cancer

Authors - Sainan Gao
  • KD Validated
humanWB

Cancers (Basel)

Differential Expression of NEK Kinase Family Members in Esophageal Adenocarcinoma and Barrett's Esophagus

Authors - Lei Chen
humanWB,IF

Int J Gen Med

NEK6 Promotes the Progression of Osteosarcoma Through Activating STAT3 Signaling Pathway by Down-Regulation of miR-26a-5p

Authors - Min Zhu
Loading...
||
New chat Able
正在加载,请稍候...