NEK6 Polyclonal antibody

NEK6 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 28070-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

EC:2.7.11.34, Never in mitosis A-related kinase 6, NimA related protein kinase 6, NimA-related protein kinase 6, Protein kinase SID6 1512

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse liver tissue, rat liver tissue
Positive IHC detected inrat liver tissue, mouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28070-1-AP targets NEK6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27887

Product name: Recombinant human NEK6 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 174-313 aa of BC000101

Sequence: KPANVFITATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVHQVAKQMHIWMSST

Predict reactive species
Full Name NIMA (never in mitosis gene a)-related kinase 6
Calculated Molecular Weight 35 kDa
Observed Molecular Weight35-40 kDa
GenBank Accession NumberBC000101
Gene Symbol NEK6
Gene ID (NCBI) 10783
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9HC98
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The Aspergillus nidulans 'never in mitosis A' (NIMA) is a serine/ threonine kinase that controls initiation of mitosis, whereas its inactivation is necessary for mitotic exit. NIMA-related kinases (NEKs) are a group of protein kinases that are homologous to NIMA. Evidence suggests that NEKs perform functions similar to those of NIMA. Human NIMA-related kinase 6 (NEK6, synonym: SID6-1512) is comprised of 338 amino acids and shows both nuclear and cytoplasmic localizations in HeLa cells. NEK6 is required for mitotic progression of human cells. NEK6 is phosphorylated and activated during M phase. Inhibition of Nek6 function by either overexpression of an inactive Nek6 mutant or elimination of endogenous Nek6 by siRNA arrests cells in M phase and triggers apoptosis. Recombinant human NEK6 protein produced in insect cells effectively phosphorylates histones H1 and H3, but not casein. Thus, these results suggest that, unlike other mammalian NIMA-related kinases, NEK6 is a mitotic histone kinase which regulates chromatin condensation in mammalian cells. NEK6 transcripts are ubiquitously expressed with the highest expression found in the heart and skeletal muscle, and the hNek6 gene is localized to human chromosome 9q33-34. NEK6 has four isoforms with MW 35-40 kDa.

Protocols

Product Specific Protocols
IF protocol for NEK6 antibody 28070-1-APDownload protocol
IHC protocol for NEK6 antibody 28070-1-APDownload protocol
WB protocol for NEK6 antibody 28070-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...