Use Able AI chat for product recommendations

NEK6 Recombinant monoclonal antibody, PBS Only

NEK6 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85728-1-PBS
Clone No.250009D2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

EC:2.7.11.34, Never in mitosis A-related kinase 6, NimA related protein kinase 6, NimA-related protein kinase 6, Protein kinase SID6 1512

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85728-1-PBS targets NEK6 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0266

Product name: Recombinant human NEK6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 6-209 aa of BC000101

Sequence: GHMPHGGSSNNLCHTLGPVHPPDPQRHPNTLSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSETTAAHSLVG

Predict reactive species
Full Name NIMA (never in mitosis gene a)-related kinase 6
Calculated Molecular Weight 35 kDa
Observed Molecular Weight 35-40 kDa
GenBank Accession NumberBC000101
Gene Symbol NEK6
Gene ID (NCBI) 10783
RRIDAB_3744325
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9HC98
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The Aspergillus nidulans 'never in mitosis A' (NIMA) is a serine/ threonine kinase that controls initiation of mitosis, whereas its inactivation is necessary for mitotic exit. NIMA-related kinases (NEKs) are a group of protein kinases that are homologous to NIMA. Evidence suggests that NEKs perform functions similar to those of NIMA. Human NIMA-related kinase 6 (NEK6, synonym: SID6-1512) is comprised of 338 amino acids and shows both nuclear and cytoplasmic localizations in HeLa cells. NEK6 is required for mitotic progression of human cells. NEK6 is phosphorylated and activated during M phase. Inhibition of Nek6 function by either overexpression of an inactive Nek6 mutant or elimination of endogenous Nek6 by siRNA arrests cells in M phase and triggers apoptosis. Recombinant human NEK6 protein produced in insect cells effectively phosphorylates histones H1 and H3, but not casein. Thus, these results suggest that, unlike other mammalian NIMA-related kinases, NEK6 is a mitotic histone kinase which regulates chromatin condensation in mammalian cells. NEK6 transcripts are ubiquitously expressed with the highest expression found in the heart and skeletal muscle, and the hNek6 gene is localized to human chromosome 9q33-34. NEK6 has four isoforms with MW 35-40 kDa.

Loading...
||
New chat

Able

正在加载,请稍候...