NEK7 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• NEK7 Recombinant monoclonal antibody (87253-1-RR)

• 

  WB analysis using 87253-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87253-1-RR (NEK7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse spleen using 87253-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 87253-1-RR (NEK7 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 87253-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 87253-1-RR (NEK7 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  FC experiment of A549 using 87253-1-RR

  1x10^6 A549 cells were intracellularly stained with 0.25 ug NEK7 Recombinant monoclonal antibody (87253-1-RR, Clone:252501C6) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

• 

  Affinity of 87253-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87253-1-RR against Human NEK7 were performed. The affinity constant is 5.65 nM.

NEK7 Uni-rAb^® Recombinant Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 87253-1-RR

Clone No.252501C6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), ELISA

Synonyms

NimA related protein kinase 7

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells, NIH/3T3 cells, C6 cells, RAW 264.7 cells
• Positive IHC detected in: mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87253-1-RR targets NEK7 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag33629

  Product name: Recombinant human NEK7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-36 aa of NM_133494

  Sequence: MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRI

• Full Name: NIMA (never in mitosis gene a)-related kinase 7
• Calculated Molecular Weight: 35
• Observed Molecular Weight: 32-35 kDa
• GenBank Accession Number: NM_133494
• Gene Symbol: NEK7
• Gene ID (NCBI): 140609
• RRID: AB_3745433
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8TDX7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mammalian NIMA-related kinases (NEKs) represent a family of serine/threonine kinases, named NEK1-NEK11, which are implicated in the control of several aspects of mitosis and are involved in non-mitotic functions (PMID: 33364979). NIMA-related kinase 7 (NEK7) is the smallest NIMA-related kinase (NEK) in mammals. NEK7 is identified as a highly conserved serine or threonine kinase, which is not only crucial for mitosis entry, cell cycle progression, cell division, and mitotic process, but also expressed in brain, heart, lung, liver, spleen, and other issues (PMID: 31787755).