NELF Recombinant monoclonal antibody

• 

  WB analysis using 83490-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83490-2-RR (NELF antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 83490-2-RR

  Biolayer interferometry (BLl) kinetic assays of 83490-2-RR against Human NELF were performed. The affinity constant is below 1 pM.

NELF Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83490-2-RR

Clone No.240482G1

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, ELISA

Synonyms

NSMF, NMDA receptor synaptonuclear signaling and neuronal migration factor, Nasal embryonic luteinizing hormone-releasing hormone factor, Nasal embryonic LHRH factor, 240482G1

---

Tested Applications

• Positive WB detected in: COLO 320 cells, HeLa cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83490-2-RR targets NELF in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34902

  Product name: Recombinant human NELF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 151-268 aa of BC016862

  Sequence: KLNVYHKGAKIWKMLIFCQGGPGHLYLLKNKVATFAKVEKEEDMIHFWKRLSRLMSKVNPEPNVIHIMGCYILGNPNGEKLFQNLRTLMTPYRVTFESPLELSAQGKQMIETYFDFRL

• Full Name: nasal embryonic LHRH factor
• Calculated Molecular Weight: 507 aa, 56 kDa
• Observed Molecular Weight: 54-60 kDa
• GenBank Accession Number: BC016862
• Gene Symbol: NELF
• Gene ID (NCBI): 26012
• RRID: AB_3671117
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q6X4W1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NSMF, also named as NELF (Nasal embryonic LHRH factor), couples NMDA-sensitive glutamate receptor signaling to the nucleus and triggers long-lasting changes in the cytoarchitecture of dendrites and spine synapse processes. NELF plays a major role in promoter-proximal pausing, a widespread phenomenon during early transcription elongation.