NELL1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NELL1 Polyclonal antibody (21783-1-AP)

NELL1 Polyclonal Antibody for ELISA

Cat No. 21783-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, ELISA

Synonyms

IDH3GL, NEL like 1 (chicken), NEL like protein 1, Nel related protein 1, NELL1, NRP1

• 

Able AI

What's the best dilution for NELL1 in ?

Chat with Able

---

Product Information

21783-1-AP targets NELL1 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16542

  Product name: Recombinant human NELL1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 120-431 aa of BC069674

  Sequence: GLRDEIRYHYIHNGKPRTEALPYRMADGQWHKVALSVSASHLLLHVDCNRIYERVIDPPDTNLPPGINLWLGQRNQKHGLFKGIIQDGKIIFMPNGYITQCPNLNHTCPTCSDFLSLVQGIMDLQELLAKMTAKLNYAETRLSQLENCHCEKTCQVSGLLYRDQDSWVDGDHCRNCTCKSGAVECRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILTKSCRECRGGVLVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGENSECKNWNTKATCECKSGYISVQGDSAY

• Full Name: NEL-like 1 (chicken)
• Calculated Molecular Weight: 810 aa, 90 kDa
• GenBank Accession Number: BC069674
• Gene Symbol: NELL1
• Gene ID (NCBI): 4745
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92832
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The Nell-1 antibody (Cat# 21783-1-AP) has 3 total citations published in Frontiers in Physiology, Journal of Endodontics, and Journal of Molecular Histology. The research fields span dental biology, including angiogenic differentiation of dental pulp stem cells, odontoblastic differentiation of human dental pulp cells, and expression/localization of Nell-1 during murine molar development. Applications cited include IHC in human and mouse samples.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Front Physiol; Novel Molecule Nell-1 Promotes the Angiogenic Differentiation of Dental Pulp Stem Cells.; Authors - Mengyue Li
human	IHC	J Endod; Nel-like Molecule 1 Contributes to the Odontoblastic Differentiation of Human Dental Pulp Cells.; Authors - Mengmeng Liu
mouse	IHC	J Mol Histol; Expression and localization of Nell-1 during murine molar development.; Authors - Tang Ronghua R