NEPRO Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NEPRO Polyclonal antibody (33450-1-AP)

• 

  WB analysis using 33450-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33450-1-AP (NEPRO antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

NEPRO Polyclonal Antibody for WB, ELISA

Cat No. 33450-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

C3orf17, Nucleolus and neural progenitor protein

---

Tested Applications

• Positive WB detected in: Jurkat cells, Raji cells, Ramos cells, SH-SY5Y cells, SK-N-SH cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33450-1-AP targets NEPRO in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38276

  Product name: Recombinant human C3orf17 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-168 aa of NM_015412.3

  Sequence: MMAAVPPGLEPWNRVRIPKAGNRSAVTVQNPGAALDLCIAAVIKECHLVILSLKSQTLDAETDVLCAVLYSNHNRMGRHKPHLALKQVEQCLKRLKNMNLEGSIQDLFELFSSNENQPLTTKVCVVPSQPVVELVLMKVLGACKLLLRLLDCCCKTFLLTVKHLGLQE

• Full Name: chromosome 3 open reading frame 17
• Calculated Molecular Weight: 65kDa，567aa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: NM_015412.3
• Gene Symbol: C3orf17
• Gene ID (NCBI): 25871
• RRID: AB_3742976
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6NW34
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The NEPRO protein (full name: Nucleolus and Neural Progenitor Protein) belongs to the NEPRO family and is primarily localized in the nucleolus. Its core function is to serve as a key downstream factor of the Notch signaling pathway during cerebral cortex development, where it maintains the stemness of neural progenitor cells by inhibiting their differentiation into neurons, thereby ensuring normal development of the nervous system. Additionally, this protein also plays an indispensable role during pre-implantation embryonic development in mice (PMID: 26178919).