NEU2 Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of PC-12 using 83934-2-RR (same clone as 83934-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed PC-12 cells using NEU2 antibody (83934-2-RR, Clone: 240685C12 ) at dilution of 1:250 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 83934-2-PBS in a different storage buffer formulation.

• 

  FC experiment of A549 using 83934-2-RR (same clone as 83934-2-PBS)

  1x10^6 A549 cells were intracellularly stained with 0.25 ug Neu2 Recombinant Antibody (83934-2-RR, Clone:240685C12) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83934-2-PBS in a different storage buffer formulation.

NEU2 Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra), ELISA

Cat No. 83934-2-PBS

Clone No.240685C12

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

IF/ICC, FC (Intra), ELISA

Synonyms

240685C12, Cytosolic sialidase, EC:3.2.1.18, N acetyl alpha neuraminidase 2, N-acetyl-alpha-neuraminidase 2

---

Product Information

83934-2-PBS targets NEU2 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag17386

  Product name: Recombinant human NEU2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 66-380 aa of BC107053

  Sequence: VQWQAQEVVAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRANVTRLCQVTSTDHGRTWSSPRDLTDAAIGPAYREWSTFAVGPGHCLQLNDRARSLVVPAYAYRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPPPQGCQGSVISFPSPRSGPGSPAQWLLYTHPTHSWQRADLGAYLNPRPPAPEAWSEPVLLAKGSCAYSDLQSMGTGPDGSPLFGCLYEANDYEEIVFLMFTLKQAFPAEYLPQ

• Full Name: sialidase 2 (cytosolic sialidase)
• Calculated Molecular Weight: 380 aa, 42 kDa
• GenBank Accession Number: BC107053
• Gene Symbol: NEU2
• Gene ID (NCBI): 4759
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9Y3R4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NEU2, also named as Sialidase 2, neuraminidase 2, catalyzes the hydrolytic cleavage of the terminal sialic acid (N-acetylneuraminic acid, Neu5Ac) of a glycan moiety in the catabolism of glycolipids, glycoproteins and oligosaccharides. NEU2 is localized in the cytosol and plasma membrane and takes part in myoblast and neuronal differentiation. It is almost undetectable under normal physiological conditions, and was found to be involved into apoptotic events in pancreatic ductal adenocarcinoma, one of the most dangerous cancers due to poor diagnosis and prognosis. (PMID: 30439363)