NEURL Polyclonal antibody

• 

  WB analysis of mouse brain using 18898-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 18898-1-AP (NEURL antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 18898-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18898-1-AP (NEURL antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Y79 using 18898-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 18898-1-AP (NEURL antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 18898-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 18898-1-AP (NEURL antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 18898-1-AP

  IP result of anti-NEURL (IP:18898-1-AP, 4ug; Detection:18898-1-AP 1:600) with mouse brain tissue lysate 2560ug.

• 

  IHC staining of mouse brain using 18898-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 18898-1-AP (NEURL antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 18898-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 18898-1-AP (NEURL antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of MCF-7 using 18898-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using NEURL antibody (18898-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

NEURL Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 18898-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

neu, h-neuralized 1, h neuralized 1, h neu, EC:2.3.2.27

---

Tested Applications

• Positive WB detected in: MCF-7 cells, mouse brain tissue, Y79 cells, SH-SY5Y cells, rat brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

18898-1-AP targets NEURL in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13531

  Product name: Recombinant human NEURL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-345 aa of BC026336

  Sequence: MGNNFSSIPSLPRGNPSRAPRGHPQNLKDSIGGPFPVTSHRCHHKQKHCPAVLPSGGLPAAPLLFHPHTKGSQILMDLSHKAVKRQASFCNAITFSNRPVLIYEQVRLKITKKQCCWSGALRLGFTSKDPSRIHPDSLPKYACPDLVSQSGFWAKALPEEFANEGNIIAFWVDKKGRVFHRINDSAVMLFFSGVRTADPLWALVDVYGLTRGVQLLDSELVLPDCLRPRSFTALRRPSLRREADDARLSVSLCDLNVPGADGDEAAPAASCPIPQNSLNSQHSRALPAQLDGDLRFHALRAGAHVRILDEQTVARVEHGRDERALVFTSRPVRVAETIFVKVTRS

• Full Name: neuralized homolog (Drosophila)
• Calculated Molecular Weight: 59 kDa
• Observed Molecular Weight: 60-62 kDa
• GenBank Accession Number: BC026336
• Gene Symbol: NEURL
• Gene ID (NCBI): 9148
• RRID: AB_10642557
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O76050
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NEURL(Neuralized-like protein 1A) is also named as NEURL1, NEURL1A, RNF67.Neurl1 is a RING-dependent E3 ubiquitin ligase that can regulate Notch signaling in mammals and it expression promotes lysosomal degradation of Jagged1 in cells and blocks signaling from Jagged1-expressing cells to neighboring Notch-expressing cells. Neurl-dependent turnover of Jagged1 and inhibition of Notch signaling depends upon N-terminal myristoylation and plasma membrane localization of Neurl1(PMID:18077452).This antibody is specific to NEURL.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	J Clin Invest; CB1 agonism prolongs therapeutic window for hormone replacement in ovariectomized mice.; Authors - Kun Zhang ; KD Validated