NEURL3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NEURL3 Polyclonal antibody, PBS Only (16648-1-PBS)

• 

  IP experiment of mouse brain using 16648-1-AP (same clone as 16648-1-PBS)

  IP result of anti-NEURL3 (IP:16648-1-AP, 3ug; Detection:16648-1-AP 1:300) with mouse brain tissue lysate 5000ug. This data was developed using the same antibody clone with 16648-1-PBS in a different storage buffer formulation.

NEURL3 Polyclonal Antibody for IP, Indirect ELISA

Cat No. 16648-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IP, Indirect ELISA

Synonyms

LINCR

---

Product Information

16648-1-PBS targets NEURL3 in IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10035

  Product name: Recombinant human NEURL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-167 aa of BC012317

  Sequence: MEMITINRTFLRSCHEDCQTPRRPERHFASMPRPRAHRCVWTRVAASRTGAPRSTTASCSASGRCAWASVWRCECCGRRAAGAAASAWASRAWTPRACPCPACRPSCAPTWRSRARRGRPCCLRAARSLGTWSASGWTAAAASSPRSTPAAGSCCVRACPSAPRSGP

• Full Name: neuralized homolog 3 (Drosophila) pseudogene
• Calculated Molecular Weight: 167 aa, 18 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC012317
• Gene Symbol: NEURL3
• Gene ID (NCBI): 93082
• RRID: AB_2878295
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96EH8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.