Home
Products
Primary Antibodies
Neurofibromin 2 Polyclonal antibody (10659-1-AP)

Neurofibromin 2 Polyclonal antibody

Neurofibromin 2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10659-1-AP

Publications (1)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

NF2, Merlin, Moesin-ezrin-radixin-like protein, Neurofibromin-2

Formulation: PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis using 10659-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 10659-1-AP (Neurofibromin 2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse kidney using 10659-1-AP
mouse kidney tissue were subjected to SDS PAGE followed by western blot with 10659-1-AP (Neurofibromin 2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of Jurkat using 10659-1-AP
Jurkat cells were subjected to SDS PAGE followed by western blot with 10659-1-AP (Neurofibromin 2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of NIH/3T3 using 10659-1-AP
NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 10659-1-AP (Neurofibromin 2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of human kidney using 10659-1-AP
human kidney tissue were subjected to SDS PAGE followed by western blot with 10659-1-AP (Neurofibromin 2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human stomach using 10659-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 10659-1-AP (Neurofibromin 2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Neurofibromin 2 in ?

Overview

Tested Applications
Product Information
Publications (1)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	Jurkat cells, human kidney tissue, mouse kidney tissue, NIH/3T3 cells, rat kidney tissue
Positive IHC detected in	human stomach tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:6000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10659-1-AP targets Neurofibromin 2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag1013 Product name: Recombinant human NF2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-82 aa of BC007279 Sequence: MVVSLRALLLALRQKPHSTGTIHEVTAQLMMSVRLSFWPVAVCSCVAQMASFILIKAPPQPQQSPQPVLSTLLFMYLPGPAR Predict reactive species
Full Name	neurofibromin 2 (merlin)
Calculated Molecular Weight	70 kDa
Observed Molecular Weight	64-66 kDa
GenBank Accession Number	BC007279
Gene Symbol	NF2
Gene ID (NCBI)	4771
RRID	AB_2149815
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P35240
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Neurofibromatosis 2 (NF2) tumor suppressor protein-merlin is involved in Hippo/SWH signaling pathway that associated with tumor suppression by restricting proliferation and promoting apoptosis. It has been reported that merlin can change to phosphorylation form which inactivates merlin tumor suppressive abilities at serine 518 induced by Rac effector p21-activated kinase 2. The mutation of the NF2 tumor suppressor gene may lead to nervous system tumors, mesotheliomas and metastatic tumors.

Publications

What published studies show

The Neurofibromin 2 Polyclonal antibody (Cat# 10659-1-AP) has 1 total citation. It appears in Journal of Experimental & Clinical Cancer Research (IF 14.3), used for Western Blot in human samples. The cited study investigates the role of KAT2B in cholangiocarcinoma growth and its interaction with SP1 to regulate NF2-YAP signaling, placing it in the field of cancer biology and tumor suppressor signaling pathways.

Species	Application	Title
human	WB	J Exp Clin Cancer Res The histone lysine acetyltransferase KAT2B inhibits cholangiocarcinoma growth: evidence for interaction with SP1 to regulate NF2-YAP signaling Authors - Wenbo Ma View Article