Neurofascin Polyclonal antibody

• 

  WB analysis of rat brain using 26351-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 26351-1-AP (Neurofascin antibody at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human brain using 26351-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 26351-1-AP (Neurofascin antibody at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human brain using 26351-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 26351-1-AP (Neurofascin antibody at dilution of 1:200 (under 40x lens).

Neurofascin Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26351-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, rat, mouse

Applications

WB, IHC, ELISA

Synonyms

KIAA0756, Neurofascin, neurofascin homolog (chicken), NFASC, NRCAML

---

Tested Applications

• Positive WB detected in: rat brain tissue
• Positive IHC detected in: human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below

Product Information

26351-1-AP targets Neurofascin in WB, IHC, ELISA applications and shows reactivity with human, rat, mouse samples.

• Tested Reactivity: human, rat, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24165

  Product name: Recombinant human NFASC protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 74-185 aa of BC137013

  Sequence: RFFNIAKDPRVSMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSMEPITQDKRVSQ

• Full Name: neurofascin homolog (chicken)
• Calculated Molecular Weight: 1347 aa, 150 kDa
• Observed Molecular Weight: 186 kDa
• GenBank Accession Number: BC137013
• Gene Symbol: Neurofascin
• Gene ID (NCBI): 23114
• RRID: AB_2880486
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O94856
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Pharmacol Res; The role of circTmeff-1 in incubation of context-induced morphine craving.; Authors - Hailei Yu
human	WB	Aging (Albany NY); Tumor-suppressive miR-3650 inhibits tumor metastasis by directly targeting NFASC in hepatocellular carcinoma.; Authors - Jian Wu
rat	WB	J Cancer Prev; Gene Expression Changes by Diallyl Trisulfide Administration in Chemically-induced Mammary Tumors in Rats.; Authors - Eun-Ryeong Hahm
human	WB	Cell Rep Med; Clinical-proteomic classification and precision treatment strategy of chordoma; Authors - Huabin Yin