NFATC2IP Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NFATC2IP Polyclonal antibody, PBS Only (11667-1-PBS)

• 

  WB analysis using 11667-1-AP (same clone as 11667-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11667-1-AP (NFATC2IP antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11667-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 11667-1-AP (same clone as 11667-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using NFATC2IP antibody (11667-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red). This data was developed using the same antibody clone with 11667-1-PBS in a different storage buffer formulation.

NFATC2IP Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 11667-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Nuclear factor of activated T-cells, cytoplasmic 2-interacting protein, NIP45, NFATC2-interacting protein, NFATC2 interacting protein, 45 kDa NFAT-interacting protein

---

Product Information

11667-1-PBS targets NFATC2IP in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2217

  Product name: Recombinant human NFATC2IP protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-218 aa of BC021551

  Sequence: PPSPRTKSRTHTRALKKLSEVNKRLQDLRSCLSPKPPQGQEQQGQEDEVVLVEGPTLPETPRLFPLKIRCRADLVRLPLRMSEPLQSVVDHMATHLGVSPSRILLLFGETELSPTATPRTLKLGVADIIDCVVLTSSPEATETSQQLQLRVQGKEKHQTLEVSLSRDSPLKTLMSHYEEAMGLSGRKLSFFFDGTKLSGRELPADLGMESGDLIEVWG

• Full Name: nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 interacting protein
• Calculated Molecular Weight: 138 aa, 15 kDa
• Observed Molecular Weight: 50-65 kDa
• GenBank Accession Number: BC021551
• Gene Symbol: NFATC2IP
• Gene ID (NCBI): 84901
• RRID: AB_3669129
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NCF5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NFATC2IP, also named as NIP45, is a 419 amino acid protein, which contains one ubiquitin-like domain. TRAF1 is associated with a fraction of NFATC2IP in the cytoplasm and prevents its translocation to the nucleus. NFATC2IP In T-helper 2 (Th2) cells, regulates the magnitude of NFAT-driven transcription of a specific subset of cytokine genes, including IL3, IL4, IL5 and IL13, but not IL2.