NFIB Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• NFIB Polyclonal antibody, PBS Only (29898-1-PBS)

• 

  WB analysis using 29898-1-AP (same clone as 29898-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29898-1-AP (NFIB antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29898-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 29898-1-AP (same clone as 29898-1-PBS)

  Immunohistochemical analysis of paraffin-embedded skin cancer slide using 29898-1-AP (NFIB antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29898-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 29898-1-AP (same clone as 29898-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using NFIB antibody (29898-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 29898-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 29898-1-AP (same clone as 29898-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using NFIB antibody (29898-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 29898-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 29898-1-AP (same clone as 29898-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using NFIB antibody (29898-1-AP) at dilution of 1:1500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 29898-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 29898-1-AP (same clone as 29898-1-PBS)

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human NFIB (29898-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 29898-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

NFIB Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 29898-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

CCAAT-box-binding transcription factor, CTF, HMGIC/NFIB, NF I/B, NF1 B

---

Product Information

29898-1-PBS targets NFIB in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31946

  Product name: Recombinant human NFIB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 180-340 aa of BC001283

  Sequence: LAYYVQEQDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYPSPSSPAAGSRTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFP

• Full Name: nuclear factor I/B
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 45-65 kDa
• GenBank Accession Number: BC001283
• Gene Symbol: NFIB
• Gene ID (NCBI): 4781
• RRID: AB_3086183
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00712
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NFIB, also named as Nuclear factor 1, is a 420 amino acid protein, which belongs to the CTF/NF-I family and may bind DNA as a homodimer. NFIB recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication. NFIB also exists in multiple isoforms in prostate cancer cells, with average molecular weights of 62 kDa, 57 kDa, and 49 kDa (PMID: 32692871).