Filter: AllWBIHC

WB analysis using 67983-1-Ig (same clone as 67983-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 67983-1-Ig (NFIX antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67983-1-PBS in a different storage buffer formulation.
×
Various lysates were subjected to SDS PAGE followed by western blot with 67983-1-Ig (NFIX antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67983-1-PBS in a different storage buffer formulation.
WB analysis of rat testis using 67983-1-Ig (same clone as 67983-1-PBS)
rat testis tissue were subjected to SDS PAGE followed by western blot with 67983-1-Ig (NFIX antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67983-1-PBS in a different storage buffer formulation.
WB analysis of A549 using 67983-1-Ig (same clone as 67983-1-PBS)
A549 cells were subjected to SDS PAGE followed by western blot with 67983-1-Ig (NFIX antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67983-1-PBS in a different storage buffer formulation.
WB analysis of HeLa using 67983-1-Ig (same clone as 67983-1-PBS)
HeLa cells were subjected to SDS PAGE followed by western blot with 67983-1-Ig (NFIX antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67983-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 67983-1-Ig (same clone as 67983-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67983-1-Ig (NFIX antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67983-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 67983-1-Ig (same clone as 67983-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67983-1-Ig (NFIX antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67983-1-PBS in a different storage buffer formulation.
IHC staining of rat brain using 67983-1-Ig (same clone as 67983-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 67983-1-Ig (NFIX antibody) at dilution of 1:1500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67983-1-PBS in a different storage buffer formulation.
IHC staining of rat brain using 67983-1-Ig (same clone as 67983-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 67983-1-Ig (NFIX antibody) at dilution of 1:1500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67983-1-PBS in a different storage buffer formulation.

NFIX Monoclonal antibody, PBS Only

NFIX Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67983-1-PBS

Clone No.1E8A1

Review Product

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat, pig, rabbit

Applications

WB, IHC, Indirect ELISA

Synonyms

CTF, NF I/X, NF1 X, NF1A, NFI X, NFIX, Nuclear factor 1 X type, Nuclear factor 1/X, Nuclear factor I/X, TGGCA binding protein

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

67983-1-PBS targets NFIX in WB, IHC, Indirect ELISA applications and shows reactivity with Human, mouse, rat, pig, rabbit samples.

Tested Reactivity	Human, mouse, rat, pig, rabbit
Host / Isotype	Mouse / IgG2b
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag31447 Product name: Recombinant human NFIX protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 246-400 aa of NM_001271043 Sequence: ADLESPSYYNINQVTLGRRSITSPPSTSTTKRPKSIDDSEMESPVDDVFYPGTGRSPAAGSSQSSGWPNDVDAGPASLKKSGKLDFCSALSSQGSSPRMAFTHHPLPVLAGVRPGSPRATASALHFPSTSIIQQSSPYFTHPTIRYHHHHGQDSL Predict reactive species
Full Name	nuclear factor I/X (CCAAT-binding transcription factor)
Calculated Molecular Weight	50 kDa
Observed Molecular Weight	45kDa, 50kDa
GenBank Accession Number	NM_001271043
Gene Symbol	NFIX
Gene ID (NCBI)	4784
RRID	AB_2918732
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q14938
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

NFIX, also named CTF, belongs to the CTF/NF-I family. NFIX recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. NFIX is individually capable of activating transcription and replication.