NFKB1 Monoclonal antibody, PBS Only (Capture)

NFKB1 Monoclonal Antibody for Cytometric bead array, Indirect ELISA
Cat No. 66992-2-PBS
Clone No.1A1F1

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

DNA binding factor KBF1, DNA-binding factor KBF1, EBP 1, EBP-1, KBF1

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66992-2-PBS targets NFKB1 as part of a matched antibody pair:

MP51119-1: 66992-2-PBS capture and 66992-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5832

Product name: Recombinant human NFKB1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-370 aa of BC051765

Sequence: MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPN

Predict reactive species
Full Name nuclear factor of kappa light polypeptide gene enhancer in B-cells 1
Calculated Molecular Weight 105 kDa
GenBank Accession NumberBC051765
Gene Symbol NFKB1
Gene ID (NCBI) 4790
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP19838
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...