NFKBID Polyclonal antibody

• 

  WB analysis using 15672-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15672-1-AP (NFKBID antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

NFKBID Polyclonal Antibody for WB, ELISA

Cat No. 15672-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

I kappa B delta, I-kappa-B-delta, IkappaBNS, IkB delta, IkB-delta

---

Tested Applications

• Positive WB detected in: A20 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15672-1-AP targets NFKBID in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8139

  Product name: Recombinant human NFKBID protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-150 aa of BC006273

  Sequence: MRSCCVVQAGLQLLASSDPPSSASQSARITGVNHRTPPREIKSNKTVLHLAVQAANPTLVQLLLELPRGDLRTFVNMKAHGNTALHMAAALPPGPAQEAIVRHLLAAGADPTLRNLENEQPVHLLRPGPGPEGLRQLLKRSRVAPPGLSS

• Full Name: nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, delta
• Calculated Molecular Weight: 150 aa, 16 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC006273
• Gene Symbol: NFKBID
• Gene ID (NCBI): 84807
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NI38
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NFKBID, also known as IkBNS, belongs to the IKB protein family of NFKB inhibitors and is induced by T-cell receptor stimulation(PMID: 11931770). NFKBID regulates the expression of IL-2, IL-6, and other cytokines through regulation on NF-kappa-B activity. NFKBID plays a role in regulating inflammatory responses. NFKBID is involved in the induction of T helper 17 cells (Th17) differentiation upon antigen recognition by T cell antigen receptor (TCR). (PMID: 25347393)