NFKBIZ Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NFKBIZ Polyclonal antibody (14014-1-AP)

• Featured Product
• KD/KO Validated

NFKBIZ Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 14014-1-AP Copied!

Publications (15)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

I kappa B zeta, IkappaB zeta, IkappaBzeta, I-kappa-B-zeta, IkB zeta

• 

  WB analysis of HeLa using 14014-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14014-1-AP (NFKBIZ antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 14014-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14014-1-AP (NFKBIZ antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 14014-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14014-1-AP (NFKBIZ Antibody) at dilution of 1:300 incubated at 4 degree celsius over night.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 14014-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14014-1-AP (NFKBIZ Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 14014-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using NFKBIZ antibody (14014-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NFKBIZ in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, THP-1 cells, U-251 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14014-1-AP targets NFKBIZ in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5120

  Product name: Recombinant human NFKBIZ protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 369-718 aa of BC060800

  Sequence: AHLHSFSMMPSSACEAMVGHEMASDSSNTSLPFSNMGNPMNTTQLGKSLFQWQVEQEESKLANISQDQFLSKDADGDTFLHIAVAQGRRALSYVLARKMNALHMLDIKEHNGQSAFQVAVAANQHLIVQDLVNIGAQVNTTDCWGRTPLHVCAEKGHSQVLQAIQKGAVGSNQFVDLEATNYDGLTPLHCAVIAHNAVVHELQRNQQPHSPEVQELLLKNKSLVDTIKCLIQMGAAVEAKDRKSGRTALHLAAEEANLELIRLFLELPSCLSFVNAKAYNGNTALHVAASLQYRLTQLDAVRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKGKSIQQRAPPY

• Full Name: nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, zeta
• Calculated Molecular Weight: 78 kDa
• Observed Molecular Weight: 78 kDa, 64 kDa
• GenBank Accession Number: BC060800
• Gene Symbol: NFKBIZ
• Gene ID (NCBI): 64332
• RRID: AB_2878000
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BYH8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NFKBIZ, also named as NF-kappa-B inhibitor zeta, is a 718 amino acid protein, which contains 7 ANK repeats and is expressed at high levels in peripheral blood leukocytes and lung, at moderate levels in liver, placenta, and at low levels in spleen, kidney, skeletal muscle and heart. NFKBIZ exists as three isoforms and molecular weight of isoform three is a 64 kDa. The isoform one is 78 kDa protein and isoform two is a 68 kDa protein. NFKBIZ is involved in regulation of NF-kappa-B transcription factor complexes. It Inhibits NF-kappa-B activity without affecting its nuclear translocation upon stimulation.

Publications

What published studies show

The NFKBIZ Polyclonal antibody (Cat# 14014-1-AP) has accumulated 15 citations published in journals including Advanced Materials, Cell Molecular Life Sciences, JCI Insight, Experimental Neurology, FASEB Journal, Phytomedicine, Frontiers in Immunology, and ACS Applied Bio Materials. Associated research fields encompass hepatocellular carcinoma, Alzheimer's disease, dry eye disease, cerebral ischemia/reperfusion, septic acute kidney injury, renal transplantation, glioblastoma, anxiety disorders, and hepatic oxidative damage.

Automatically generated from the 15 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Exploration (Beijing); An Ocular Surface-Targeting Nucleic Acid Hydrogel for Efficient Dry Eye Disease Treatment.; Authors - Yuhe Liu
mouse,human	WB,IF	Adv Mater; Membrane Fusion-Mediated Loading of Therapeutic siRNA into Exosome for Tissue-Specific Application; Authors - Miao Xie
human	WB,IF	J Nanobiotechnology; Itaconate-functionalized tetrahedral framework nucleic acids break the dry eye vicious cycle through dual antioxidant and anti-inflammatory actions.; Authors - Kai Jiang
mouse	WB	Phytomedicine; Ginkgo biloba Extract GBE50 ameliorates cerebrovascular dysfunction and cognitive impairment in a mouse model of Alzheimer's disease; Authors - Ting Yu
		Int J Biol Macromol; Charaterization and immunomodulatory activities of polysaccharide isolated from Pleurotus eryngii.; Authors - Duoduo Xu
human	WB	Front Immunol; Single-Cell Transcriptome Analysis of Chronic Antibody-Mediated Rejection After Renal Transplantation.; Authors - Fanhua Kong