NFU1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NFU1 Polyclonal antibody (25598-1-AP)

NFU1 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 25598-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, ELISA

Synonyms

CGI 33, HIRA interacting protein 5, HIRIP5, Nfu, NFU1, NifU, NIFUC

• 

  WB analysis of mouse cerebellum using 25598-1-AP

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 25598-1-AP (NFU1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 25598-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 25598-1-AP (NFU1 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse cerebellum using 25598-1-AP

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 25598-1-AP (NFU1 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 25598-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 25598-1-AP (NFU1 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 25598-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 25598-1-AP (NFU1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 25598-1-AP

  IP result of anti-NFU1 (IP:25598-1-AP, 4ug; Detection:25598-1-AP 1:1000) with mouse brain tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 25598-1-AP

  Immunofluorescent analysis of HepG2 cells using 25598-1-AP (NFU1 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NFU1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse cerebellum tissue, mouse brain tissue, mouse testis tissue
• Positive IP detected in: mouse brain tissue
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25598-1-AP targets NFU1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22343

  Product name: Recombinant human NFU1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-254 aa of BC113692

  Sequence: MAATARRGWGAAAVAAGLRRRFCHMLKNPYTIKKQPLHQFVQRPLFPLPAAFYHPVRYMFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDFITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGSEEDDEVVAMIKELLDTRIRPTVQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQVMDDESDEKEANSP

• Full Name: NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae)
• Calculated Molecular Weight: 254 aa, 28 kDa
• Observed Molecular Weight: 23-28 kDa
• GenBank Accession Number: BC113692
• Gene Symbol: NFU1
• Gene ID (NCBI): 27247
• RRID: AB_2880151
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UMS0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NFU1, also named as HIRA-interacting protein 5 or CGI-33, is a 254 amino acid protein, which belongs to the NifU family. NFU1 localizes in the Mitochondrion. NFU1 is widely expressed in adult tissues. NFU1, as an Iron-sulfur cluster scaffold protein, which can assemble clusters and deliver them to target proteins. It has an association with Multiple mitochondrial dysfunctions syndrome 1.

Publications

What published studies show

The NFU1 Polyclonal antibody (Cat# 25598-1-AP) has 2 total citations. One appeared in Science (2023), studying autoregulatory control of mitochondrial glutathione homeostasis. The other was published in Redox Biology (2025), investigating how iron overload promotes tubular cuproptosis in renal ischemia-reperfusion injury via LIAS dysfunction. Both citations used the antibody for Western blot in human samples, reflecting its application in mitochondrial metabolism and redox biology research.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Science; Autoregulatory control of mitochondrial glutathione homeostasis; Authors - Yuyang Liu
	WB	Redox Biol; Iron overload exaggerates renal ischemia-reperfusion injury by promoting tubular cuproptosis via interrupting function of LIAS; Authors - Siyue Chen