NGF Polyclonal antibody

• 

NGF Polyclonal Antibody for ELISA

Cat No. 20600-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA

Synonyms

Beta NGF, Beta nerve growth factor, proNGF, NGFB, Beta-NGF

---

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

20600-1-AP targets NGF in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14569

  Product name: Recombinant human NGF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 180-300 aa of BC032517

  Sequence: SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA

• Full Name: nerve growth factor (beta polypeptide)
• Calculated Molecular Weight: 241 aa, 27 kDa
• GenBank Accession Number: BC032517
• Gene Symbol: NGF
• Gene ID (NCBI): 4803
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P01138
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	IHC	Bioorg Chem; Novel 2,6-disubstituted benzofuran-3-one analogues improve cerebral ischemia/reperfusion injury via neuroprotective and antioxidative effects; Authors - Zunhua Yang
rat	WB	Eur J Pain; Gene transfer of a naked plasmid (pUDK-HGF) encoding human hepatocyte growth factor attenuates skin/muscle incision and retraction-induced chronic post-surgical pain in rats.; Authors - C Hu