Product Information
20600-1-AP targets NGF in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14569 Product name: Recombinant human NGF protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 180-300 aa of BC032517 Sequence: SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA Predict reactive species |
| Full Name | nerve growth factor (beta polypeptide) |
| Calculated Molecular Weight | 241 aa, 27 kDa |
| GenBank Accession Number | BC032517 |
| Gene Symbol | NGF |
| Gene ID (NCBI) | 4803 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01138 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Publications
| Species | Application | Title |
|---|---|---|
Bioorg Chem Novel 2,6-disubstituted benzofuran-3-one analogues improve cerebral ischemia/reperfusion injury via neuroprotective and antioxidative effects | ||
Eur J Pain Gene transfer of a naked plasmid (pUDK-HGF) encoding human hepatocyte growth factor attenuates skin/muscle incision and retraction-induced chronic post-surgical pain in rats. |
