Filter: AllWBIHC

WB analysis using 10446-1-AP (same clone as 10446-1-PBS)
HepG2 lysates were subjected to SDS PAGE followed by western blot with 10446-1-AP (NGFRAP1 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10446-1-PBS in a different storage buffer formulation.
WB analysis of mouse liver using 10446-1-AP (same clone as 10446-1-PBS)
mouse liver tissue were subjected to SDS PAGE followed by western blot with 10446-1-AP (NGFRAP1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10446-1-PBS in a different storage buffer formulation.
IHC staining of human stomach cancer using 10446-1-AP (same clone as 10446-1-PBS)
Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 10446-1-AP (NGFRAP1 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Sodium Citrate buffer (pH 6.0). This data was developed using the same antibody clone with 10446-1-PBS in a different storage buffer formulation.

NGFRAP1 Polyclonal antibody, PBS Only

Name: NGFRAP1 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 10446-1-PBS

NGFRAP1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 10446-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

NADE, HGR74, DXS6984E, Brain-expressed X-linked protein 3, BEX3

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

10446-1-PBS targets NGFRAP1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag0378 Product name: Recombinant human NGFRAP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 4-111 aa of BC003190 Sequence: IHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP Predict reactive species
Full Name	nerve growth factor receptor (TNFRSF16) associated protein 1
Calculated Molecular Weight	13 kDa, 22 kDa, 44 kDa
Observed Molecular Weight	28 kDa
GenBank Accession Number	BC003190
Gene Symbol	NGFRAP1
Gene ID (NCBI)	27018
RRID	AB_2152792
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q00994
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™