NGRN Monoclonal antibody, PBS Only

• 

  WB analysis using 68593-1-Ig (same clone as 68593-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68593-1-Ig (NGRN antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 68593-1-PBS in a different storage buffer formulation.

NGRN Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68593-1-PBS

Clone No.2C2C9

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, Indirect ELISA

Synonyms

DSC92, FI58G, Neugrin, NGRN

---

Product Information

68593-1-PBS targets NGRN in WB, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6790

  Product name: Recombinant human NGRN protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-219 aa of BC001682

  Sequence: MEAPGAPPRTLTWEAMEQIRYLHEEFPESWSVPRLAEGFDVSTDVIRRVLKSKFLPTLEQKLKQDQKVLKKAGLAHSLQHLRGSGNTSKLLPAGHSVSGSLLMPGHEASSKDPNHSTALKVIESDTHRTNTPRRRKGRNKEIQDLEESFVPVAAPLGHPRELQKYSSDSESPRGTGSGALPSGQKLEELKAEEPDNFSSKVVQRGREFFDSNGNFLYRI

• Full Name: neugrin, neurite outgrowth associated
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 30-32 kDa
• GenBank Accession Number: BC001682
• Gene Symbol: NGRN
• Gene ID (NCBI): 51335
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9NPE2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NGRN, also named as Neugrin or FI58G, is a 291 amino acid protein, which belongs to the neugrin family. NGRN localizes in the nucleus and is expressed at high levels in heart, brain and skeletal muscle. In brain, it is mainly expressed in neurons rather than glial cells. NGRN may be involved in neuronal differentiation.