NHE2 Polyclonal antibody

NHE2 Polyclonal Antibody for WB, ELISA
Cat No. 25105-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Na(+)/H(+) exchanger 2, NHE 2, NHE2, NHE2/SLC9A2, SLC9A2, Sodium/hydrogen exchanger 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, rat brain tissue, mouse stomach tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25105-1-AP targets NHE2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18801

Product name: Recombinant human SLC9A2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 686-812 aa of BC136377

Sequence: ISIADGNSSDSDADAGTTVLNLQPRARRFLPEQFSKKSPQSYKMEWKNEVDVDSGRDMPSTPPTPHSREKGTQTSGLLQQPLLSKDQSGSEREDSLTEGIPPKPPPRLVWRASEPGSRKARFGSEKP

Predict reactive species
Full Name solute carrier family 9 (sodium/hydrogen exchanger), member 2
Calculated Molecular Weight 812 aa, 92 kDa
Observed Molecular Weight70 kDa
GenBank Accession NumberBC136377
Gene Symbol NHE2/SLC9A2
Gene ID (NCBI) 6549
RRIDAB_3085771
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UBY0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NHE2, also known as SLC9A2, is a protein-coding gene mainly at the top of gastrointestinal epithelial cells. It mainly encodes a member of the sodium-hydrogen exchanger (NHE) protein family, which is localized to the apical membrane and is easily degraded by lysosomes, resulting in a short half-life. NHE2 is involved in sodium ion transport by exchanging intracellular hydrogen ions into external sodium ions, and helps in the regulation of cell pH and volume to eliminate acids produced by active metabolism or against adverse environmental conditions. NHE2 is widely distributed in tissues of the gastrointestinal tract, kidney, heart, testes, uterus, and adrenal glands (PMID: 37688782). The observed molecular weight of NHE2 is 70 kDa, which might be the unmodified form of NHE2 (PMID: 10444453, 10666043).

Protocols

Product Specific Protocols
WB protocol for NHE2 antibody 25105-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...