NHS Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NHS Polyclonal antibody (31487-1-AP)

• 

  IHC staining of human liver using 31487-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 31487-1-AP (NHS antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 31487-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 31487-1-AP (NHS antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

NHS Polyclonal Antibody for IHC, ELISA

Cat No. 31487-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

SCML1

---

Tested Applications

• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31487-1-AP targets NHS in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34757

  Product name: Recombinant human NHS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1532-1651 aa of BC136415

  Sequence: YRMSATEILKSPILPKPPGELTAESPQSTDDAHQGSQGAEALSPLSPCSPRVNAEGFSSKSFATSASARVGRSRAPPAASSSRYSVRCRLYNTPMQAISEGETENSDGSPHDDRSSQSST

• Full Name: Nance-Horan syndrome (congenital cataracts and dental anomalies)
• GenBank Accession Number: BC136415
• Gene Symbol: NHS
• Gene ID (NCBI): 4810
• RRID: AB_3742435
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6T4R5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NHS (Nance-Horan syndrome protein), also named Actin remodeling regulator NHS, may function in cell morphology by maintaining the integrity of the circumferential actin ring and controlling lamellipod formation. Involved in the regulation eye, tooth, brain, and craniofacial development (PMID: 20332100).