NIP7 Polyclonal antibody

• 

  WB analysis using 16839-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16839-1-AP (NIP7 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 16839-1-AP

  IP result of anti-NIP7 (IP:16839-1-AP, 4ug; Detection:16839-1-AP 1:1000) with HeLa cells lysate 1600 ug.

NIP7 Polyclonal Antibody for WB, IP, ELISA

Cat No. 16839-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

CGI 37, HSPC031, HSPC180, KD93, NIP7, OK/SW cl.76, OK/SW cl.78

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells
• Positive IP detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16839-1-AP targets NIP7 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10526

  Product name: Recombinant human NIP7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-180 aa of BC015941

  Sequence: MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT

• Full Name: nuclear import 7 homolog (S. cerevisiae)
• Calculated Molecular Weight: 180 aa, 20 kDa
• Observed Molecular Weight: 20-22 kDa
• GenBank Accession Number: BC015941
• Gene Symbol: NIP7
• Gene ID (NCBI): 51388
• RRID: AB_2153549
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y221
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nip7 was initially identified in yeast as required for processing of the 27S pre-rRNA to form the mature 25S and 5.8S rRNAs (PMID: 9891085). It localizes to the nucleolus but was also found to sediment in the region of free 60S subunits in sucrose density gradients (PMID: 9891085). Experimental evidence suggests that the P. abyssi Nip7 may be an exosome regulatory factor. It binds preferentially to U- and AU-rich RNAs and strongly inhibits the exosome due to its association with both the exosome complex and the substrate RNA.