Product Information
27077-1-PBS targets NIPA1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23847 Product name: Recombinant human NIPA1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 194-277 aa of BC025678 Sequence: RYINKALECFDSSVFGAIYYVVFTTLVLLASAILFREWSNVGLVDFLGMACGFTTVSVGIVLIQVFKEFNFNLGEMNKSNMKTD Predict reactive species |
| Full Name | non imprinted in Prader-Willi/Angelman syndrome 1 |
| Calculated Molecular Weight | 35 kDa |
| Observed Molecular Weight | 27 kDa |
| GenBank Accession Number | BC025678 |
| Gene Symbol | NIPA1 |
| Gene ID (NCBI) | 123606 |
| RRID | AB_3085923 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q7RTP0 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Nonimprinted in Prader-Willi/Angelman loci 1 (NIPA1, also known as SPG6) gene is located in the pericentromeric region of chromosome 15q and encodes a magnesium transporter located in the plasma membrane and early endosomes, implicated in neuronal development and maintenance (PMID: 17166836). NIPA1 is highly conserved along phylogeny and highly expressed in neuronal tissues.

