NIPSNAP3A Polyclonal antibody

• 

  WB analysis using 10751-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10751-1-AP (NIPSNAP3A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of COLO 320 using 10751-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 10751-1-AP (NIPSNAP3A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 10751-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10751-1-AP (NIPSNAP3A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 10751-1-AP

  IP result of anti-NIPSNAP3A (IP:10751-1-AP, 4ug; Detection:10751-1-AP 1:1000) with mouse brain tissue lysate 4000ug.

• 

  IHC staining of human colon cancer using 10751-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10751-1-AP (NIPSNAP3A Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human colon cancer using 10751-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10751-1-AP (NIPSNAP3A Antibody) at dilution of 1:200 (under 40x lens).

• 

  IF Staining of HEK-293 using 10751-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using NIPSNAP3A antibody (10751-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

NIPSNAP3A Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10751-1-AP

Publications(1)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

TassC, Target for Salmonella secreted protein C, Protein NipSnap homolog 4, Protein NipSnap homolog 3A, NipSnap4

---

Tested Applications

• Positive WB detected in: mouse brain tissue, COLO 320 cells, HEK-293 cells, rat brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

10751-1-AP targets NIPSNAP3A in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1143

  Product name: Recombinant human NIPSNAP3A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-247 aa of BC005935

  Sequence: MLVLRSALTRALASRTLAPQMCSSFATGPRQYDGIFYEFRSYYLKPSKMNEFLENFEKNAHLRTAHSELVGYWSVEFGGRMNTVFHIWKYDNFAHRTEVRKALAKDKEWQEQFLIPNLALIDKQESEITYLVPWCKLEKPPKEGVYELATFQMKPGGPALWGDAFKRAVHAHVNLGYTKLVGVFHTEYGALNRVHVLWWNESADSRAAGRHKSHEDPRVVAAVRESVNYLVSQQNMLLIPTSFSPLK

• Full Name: nipsnap homolog 3A (C. elegans)
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 28-33 kDa
• GenBank Accession Number: BC005935
• Gene Symbol: NIPSNAP3A
• Gene ID (NCBI): 25934
• RRID: AB_2298420
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UFN0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Gene; NIPSNAP3A regulates cellular homeostasis by modulating mitochondrial dynamics; Authors - Run Yan ; KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Kristina (Verified Customer) (01-20-2022)

I tried a few antibodies for NIPSNAP3A in the past and this one was the most precise with the best result so far.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: LUHMES

NIPSNAP3A Antibody Western Blot validation (1:1000 dilution) in LUHMES (Cat no:10751-1-AP)